Details for Lyrate rockcress Locus 16062118

Position : sca3 ( 5`- 2045465 .. 2045950 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16062118

Protein [Map View]
MEYYQPVEINVLSAQDLDSVNLLFRPTVYVSVSVTRGSRDKQVTPAAACGKKLLRWNYRMKFYIEDDKFRRNDSVFVFQI
KCKRFFGSDQVVGKVFVPLFLGYLCKKV*

DNA
ATGGAGTATTATCAACCGGTGGAGATTAACGTTCTCTCAGCTCAAGATCTCGACTCCGTCAATCTTTTGTTCAGACCAAC
AGTCTATGTTTCCGTCTCGGTCACACGTGGTTCACGTGACAAGCAAGTCACTCCAGCTGCTGCATGCGGTAAGAAACTCT
TACGGTGGAATTACCGTATGAAATTCTATATAGAAGATGACAAATTTCGAAGGAATGACTCAGTGTTTGTGTTTCAAATA
AAGTGTAAGAGATTTTTCGGGTCTGACCAAGTCGTTGGGAAAGTTTTTGTACCGTTGTTTTTGGGTTATTTATGTAAAAA
AGTGTAA