Details for Lyrate rockcress Locus 16062076

Position : sca3 ( 5`- 6531953 .. 6529224 -3` )
Annotation : [B2G] peptidyl-prolyl cis-trans isomerase chloroplast
External links : CoGe
PGDD synteny : 16062076

Protein [Map View]
MASPLSSSTVVSHRIFFLNPSPLNRKFLFVKPKSPFNRTNSGDFRMQCSKNGTKELIHSCNSSIDSKLNPFEAGSKNLEK
LVATILIFVQVWSPLPLLGLDSAYISPAEAVLYSPDTKVPRTGELALRRAIPANPSMKIIQASLEDISYLLRIPQRKPYG
TMESNVKKALKVAIDDKDKILASIPADLKDKGSELYATLIDGKGGLQALKTSIKKQDPDKVSLGLAASLDTVADLELLQA
SGLSFLLPQQYLNYPRLAGRGTVEITIEKGDGSTFSAAAGGDQRKSATIQIVIDGYSAPLTAGNFAKLVTSGAYDGAKLN
TVNQAVITEDGSGKVESVSVPLEVMPSGQFEPLYRTPLSVQDGELPVLPLSVYGAVAMAHSETSDEYSSPYQFFFYLYDK
RNSGLGGLSFDEGQFSVFGYTTAGKDILGQIKTGDIIKSAKLIEGQDRLILPAQNNNNINSST*

DNA
ATGGCTTCTCCTTTGTCATCTTCCACCGTCGTCTCTCACCGGATTTTCTTCCTCAACCCTTCGCCTCTCAATCGTAAATT
CCTCTTCGTAAAACCCAAATCACCCTTTAATCGAACCAATTCCGGAGATTTCCGCATGCAATGCTCTAAGAATGGCACTA
AGGAACTTATACATTCCTGCAATTCTTCAATTGATTCAAAGTTGAACCCTTTTGAAGCTGGATCTAAAAACCTCGAGAAA
TTGGTTGCAACGATATTGATATTTGTTCAAGTTTGGTCTCCATTGCCCTTGCTTGGTCTAGACTCTGCTTACATTTCACC
TGCAGAGGCAGTTCTTTACTCTCCGGACACGAAAGTTCCAAGAACTGGCGAACTTGCTCTAAGGAGGGCTATTCCTGCTA
ATCCAAGCATGAAGATAATACAGGCTTCATTGGAAGATATATCATATCTTCTCAGAATTCCTCAAAGAAAGCCTTATGGT
ACCATGGAGAGCAATGTAAAGAAAGCTCTAAAGGTGGCTATAGACGATAAGGATAAGATATTGGCTAGTATACCAGCAGA
CTTAAAAGACAAGGGCTCAGAACTGTATGCAACTCTGATTGATGGCAAGGGTGGCCTTCAAGCACTTAAAACATCTATTA
AGAAACAAGATCCTGATAAAGTGTCCCTTGGCCTGGCAGCATCACTAGATACTGTTGCGGATCTGGAGTTATTACAGGCA
TCTGGGTTGTCATTTTTACTTCCTCAGCAATACTTAAACTATCCCAGGTTAGCAGGAAGAGGAACTGTGGAAATCACCAT
TGAGAAAGGTGATGGTTCAACATTTTCAGCTGCAGCTGGGGGTGATCAAAGAAAGAGTGCTACAATCCAGATCGTTATAG
ATGGATATTCAGCACCTCTAACAGCAGGGAATTTTGCAAAACTGGTAACTAGCGGTGCATATGATGGAGCCAAACTCAAT
ACAGTGAACCAGGCTGTTATCACAGAGGATGGGAGTGGTAAGGTGGAGAGTGTTAGTGTTCCATTGGAAGTAATGCCTTC
TGGACAGTTCGAACCTCTCTACCGAACCCCATTGAGTGTCCAGGATGGGGAGTTACCAGTTCTTCCTTTATCGGTTTATG
GAGCTGTTGCAATGGCGCACAGTGAAACCTCAGACGAATACTCTTCTCCTTACCAATTCTTCTTCTACCTATACGATAAA
AGAAATTCTGGCTTGGGAGGTTTATCCTTTGACGAAGGGCAGTTCTCGGTTTTTGGATACACAACAGCAGGAAAAGATAT
TCTTGGGCAGATCAAGACTGGAGATATCATCAAATCTGCAAAACTAATTGAAGGCCAAGATCGCCTTATTTTGCCTGCTC
AAAACAACAACAACATCAACTCATCCACTTGA