Details for Lyrate rockcress Locus 16062075

Position : sca1 ( 5`- 7782707 .. 7779953 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_335111 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16062075

Protein [Map View]
MPVSTRSKVMKQERNEQENTNLNLPLRNPHQGLKEKMRALTLLYEQQKRASFSLRNPNQSPKPDDQRFKTQLLDSCKKGD
RFHRQDGKDSKFIEEETKENNVFEADRIFGVNSVPVKPSSGVIRKLSMGIGARNVTEAEKLDSLDASVSRILVFVRLRPM
GKKERENGARCCVKILNKRDVYLTEFTNENDYLRLKRLRVRHFTFDSSFPETTTQQEVYSTTTGDLVEAVLEGRNGSVFC
YGATGAGKTYTMLGTMENPGVMVLAIKDLFAKVRQRSLDGNHVVHLSYLEVYNETVRDLLSPGRPLILREDKQGIVAAGL
TQYRAYSTDEVMALLQRGNQNRTTEPTRCNETSSRSHAILQVIVEYKTRDASMNIISRVGKLSLIDLAGSERALATDQRT
LRSLEGANINRSLLALSSCINALVEGKKHIPYRNSKLTQLLKDSLGGSCNTVMIANISPSSQSFGETQNTLHWADRAKEI
RMKGCEVNEEVVQMGEEEGADQAKLLLELQKENCELRVQLAKQQQKLLTLQAENLAAANNNNNNNISLTPPSISSLMTPP
SALTAQQKKKPRHSLLSGTCFTPESSKRTKAEEAVKELQLTVKALKMEMERMKREHGLQMKKQKEELMKDLCSRKSEKTP
ERGKETRRIVTRGSLRPKEKEKELKSPSHRFASPAAAAKKRSFWDITVANTSPASDRRKTRSHGLVHQEAPSKLLQPGFA
RPQMKH*

DNA
ATGCCGGTATCTACTCGATCCAAGGTGATGAAACAGGAGCGAAATGAGCAAGAAAACACAAATCTGAATCTTCCGTTGAG
AAATCCACATCAAGGGTTGAAAGAAAAGATGAGAGCTTTGACTCTCTTGTACGAGCAGCAAAAGAGAGCTTCTTTCTCTC
TCAGGAACCCTAATCAGTCTCCTAAACCCGATGACCAGAGATTCAAGACTCAGCTGCTTGATTCTTGCAAGAAAGGAGAC
AGATTTCATCGCCAAGACGGTAAAGATTCTAAATTTATTGAAGAAGAAACCAAAGAGAACAATGTATTCGAAGCAGATCG
GATTTTCGGGGTTAATTCGGTTCCTGTTAAGCCTAGTAGTGGTGTGATTAGAAAGCTCTCAATGGGTATTGGAGCTAGAA
ACGTTACAGAAGCTGAAAAATTGGATAGTCTTGATGCTTCTGTGAGTCGGATTTTGGTGTTTGTGAGGCTTAGACCAATG
GGGAAAAAGGAAAGAGAGAATGGGGCAAGATGTTGTGTCAAGATTTTGAATAAAAGAGATGTTTATCTAACGGAGTTTAC
GAATGAGAACGATTACCTTAGGCTTAAGAGGCTCCGTGTTCGACATTTCACTTTTGATTCTTCATTTCCTGAAACTACCA
CACAACAAGAGGTTTATTCCACCACAACAGGAGATCTTGTTGAAGCAGTTCTTGAAGGAAGAAATGGTTCGGTTTTCTGC
TACGGTGCTACGGGAGCAGGCAAGACTTATACGATGTTAGGGACAATGGAGAATCCAGGTGTTATGGTTTTAGCAATCAA
AGATTTGTTTGCTAAAGTTAGACAGAGAAGCTTAGATGGGAACCATGTTGTTCATCTTTCTTATCTTGAGGTTTATAATG
AAACTGTTCGAGATTTGCTTTCACCTGGTAGACCTCTCATTCTCCGCGAAGATAAGCAGGGAATTGTGGCTGCTGGTCTC
ACTCAATATAGAGCTTACTCAACAGATGAGGTTATGGCTTTGCTCCAAAGGGGAAATCAAAACAGAACTACCGAGCCAAC
TCGTTGCAACGAAACATCTTCTCGCTCACACGCCATCCTTCAGGTAATAGTGGAGTATAAGACTAGAGATGCTTCCATGA
ATATCATCAGCCGGGTAGGAAAGCTATCTCTCATTGATCTTGCCGGTTCTGAAAGAGCGCTAGCAACTGATCAAAGGACA
CTCAGATCACTGGAAGGAGCAAATATAAACAGATCACTTCTCGCATTAAGTAGTTGCATTAACGCGCTTGTGGAAGGCAA
GAAACATATTCCTTACAGAAACTCAAAGCTCACACAACTACTAAAAGACTCACTAGGCGGCTCGTGTAACACGGTGATGA
TTGCTAATATAAGTCCAAGCAGTCAATCTTTTGGTGAAACACAAAACACTCTCCATTGGGCTGATCGAGCCAAGGAGATT
CGTATGAAGGGATGTGAAGTAAATGAAGAGGTGGTTCAAATGGGTGAAGAAGAAGGGGCTGATCAGGCCAAGCTCTTGTT
AGAGCTTCAAAAAGAGAACTGTGAATTGCGTGTCCAGCTCGCGAAGCAGCAGCAAAAGCTTTTGACTCTTCAAGCAGAGA
ACTTAGCCGCTGCTAATAACAACAACAACAACAACATTTCTCTGACACCTCCATCAATCTCATCTCTAATGACTCCACCA
TCTGCGTTAACAGCTCAGCAGAAGAAGAAACCAAGGCATTCGTTGTTATCAGGGACATGTTTCACACCAGAATCATCCAA
AAGGACAAAAGCAGAAGAAGCTGTGAAGGAACTTCAGCTGACTGTAAAGGCATTGAAGATGGAGATGGAGAGAATGAAGA
GGGAACATGGGTTGCAGATGAAGAAGCAAAAAGAAGAATTAATGAAAGATCTTTGTAGTAGAAAGAGCGAGAAAACTCCA
GAAAGAGGCAAAGAAACAAGGAGGATTGTCACAAGAGGGAGCTTGAGACCAAAGGAGAAGGAGAAGGAGCTGAAAAGCCC
GAGTCATCGGTTTGCATCTCCAGCTGCAGCAGCTAAAAAGAGAAGCTTTTGGGACATAACCGTAGCTAATACTAGTCCTG
CGTCGGATAGAAGGAAAACTAGAAGCCACGGTCTTGTTCATCAAGAAGCTCCTTCAAAGCTGCTTCAGCCCGGGTTTGCT
CGTCCACAGATGAAGCATTAA