Details for Lyrate rockcress Locus 16061995

Position : sca3 ( 5`- 1117900 .. 1115252 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16061995

Protein [Map View]
MQTRVSSAFISRALSSSSNLNELRRIHALVISLGLDGSDFFSGKLIDKYSHFRAPASSLSVFRRVSPAKNVYIWNSIIRA
FSKNGWFPKALEFYGKLRESKVSPDKYTFPSVIKACAGLFDAEMGDLVYKQILEMGFESDLYVGNALVDMYSRMGLLSRA
RQVFDEMPVRDLVSWNSLISGYSSHGYYEEALEIYHELRNSWIVPDSFTVSSVLPAFANLLVVKQGQGLHGFTLKSGVNS
VSVVNNGLLAMYLKFSRPTDARRVFDEMVVRDSVTYNTMICGYLKLEMVEESVKMFLENLDQFKPDILTVTSVLCACGHL
RDLSLAKYIYNYMLRAGFVLESTVKNILIDVYAKCGDMITARDVFNSMECKDTVSWNSIISGYIQSGDLMEAMKLFKMMM
IMEEQADHITYLMLISLSTRLADLKFGKGLHSNGIKSGIYIDLSVSNALIDMYAKCGEVGDSLKIFNSMGTLDTVTWNTV
ISACVRFGDFATGLQVTTQMRKNKVVPDMATFLVTLPMCASLAAKRLGKEIHCCLLRFGYESELQIGNALIEMYSKCGCL
ESSFRVFERMSRRDVVTWTGMIYAYGMYGEGEKALESFVDMEKSGIVPDSVVFIALIYACSHSGLVEKGLACFEKMKTHY
KIDPMIEHYACVVDLLSRSQKISKAEEFIQAMPIEPDASIWASVLRACRTSGDMETAERVSRRIIELNPDDPGYSILASN
AYAALRKWDKVSLIRKSVRDKHIKKNPGYSWIEIGKKVHVFCSGDDSAPQSEAIHKSLEILYSLMAKEGYIPDSREVSQN
LEEEEEKRRLICGHSERLAIAFGLLNTEPGTPLQVMKNLRVCSDCHEVTKLISKIVGREILVRDANRFHLFKDGICSCKD
RW*

DNA
ATGCAGACTAGAGTGTCATCGGCTTTCATCTCTAGAGCTCTTTCATCGTCATCTAACCTCAATGAGCTTCGTCGAATTCA
CGCCCTTGTGATCTCTCTTGGTCTTGACGGCTCCGACTTCTTCTCCGGCAAGCTTATCGACAAGTACTCTCACTTTCGTG
CTCCCGCCTCTTCCCTCTCTGTTTTCCGACGAGTTTCTCCGGCCAAAAATGTTTATATTTGGAATTCCATCATCAGAGCG
TTTTCTAAGAATGGTTGGTTCCCTAAAGCCCTCGAGTTTTACGGGAAACTCCGGGAATCCAAGGTTTCGCCTGATAAGTA
CACGTTTCCTTCGGTTATCAAAGCCTGTGCGGGATTGTTCGATGCGGAGATGGGAGATTTGGTTTATAAGCAGATATTGG
AAATGGGTTTTGAATCGGATTTATATGTAGGCAATGCACTTGTAGATATGTATTCGAGAATGGGATTGTTAAGTAGAGCA
CGACAAGTGTTCGACGAAATGCCTGTGAGAGATCTCGTGTCCTGGAACAGTTTAATTTCTGGGTATAGTTCCCATGGTTA
CTATGAGGAAGCTTTGGAAATTTATCATGAGTTGAGGAATTCTTGGATTGTACCAGATTCCTTCACGGTTTCAAGTGTTT
TGCCTGCCTTTGCGAATTTGCTGGTTGTCAAACAAGGACAGGGACTTCATGGTTTTACTCTGAAGTCAGGTGTTAATTCT
GTTTCGGTGGTTAACAATGGACTACTTGCAATGTACTTGAAATTTAGCAGACCAACAGATGCAAGACGAGTTTTTGATGA
GATGGTCGTTCGAGATTCTGTTACTTACAATACTATGATCTGCGGATATCTCAAGCTAGAGATGGTTGAAGAATCTGTGA
AGATGTTTTTGGAAAACTTAGATCAGTTCAAGCCAGATATCTTAACTGTTACTTCTGTTCTCTGTGCCTGCGGACACTTA
CGGGACTTGAGCTTGGCAAAGTACATTTACAACTATATGCTGAGAGCGGGATTTGTTCTTGAATCTACTGTTAAAAACAT
TCTAATTGATGTGTATGCAAAGTGTGGTGACATGATCACTGCAAGAGATGTTTTCAACAGCATGGAATGCAAGGATACTG
TTTCCTGGAACTCGATAATCAGTGGATATATACAAAGCGGAGATCTTATGGAAGCCATGAAACTCTTCAAGATGATGATG
ATCATGGAAGAGCAGGCTGATCACATCACTTATTTGATGCTTATATCTCTCTCCACGCGTCTAGCAGACTTGAAATTTGG
GAAAGGGCTACACTCGAATGGGATAAAATCTGGAATTTATATCGATCTTTCTGTTAGTAATGCTTTGATTGATATGTATG
CAAAGTGCGGGGAAGTAGGAGATTCTCTGAAGATATTCAATAGTATGGGAACTCTGGATACGGTAACATGGAACACGGTT
ATTTCAGCATGTGTTCGTTTTGGGGATTTCGCAACCGGTTTGCAGGTAACTACTCAAATGAGAAAGAACAAAGTGGTGCC
TGATATGGCTACTTTCTTAGTTACATTGCCTATGTGTGCTTCACTTGCTGCAAAACGACTAGGCAAGGAGATCCATTGTT
GTCTTTTAAGGTTTGGATATGAATCGGAGTTGCAAATAGGGAATGCACTAATTGAAATGTATTCAAAATGTGGTTGTTTG
GAGAGTTCGTTTAGAGTCTTTGAACGTATGAGTAGAAGAGATGTTGTGACATGGACGGGGATGATCTATGCATATGGAAT
GTATGGTGAAGGTGAGAAAGCTCTTGAATCTTTTGTTGATATGGAAAAATCCGGTATTGTTCCCGATAGTGTTGTCTTCA
TTGCCCTCATCTATGCTTGCAGCCACTCTGGTCTGGTAGAAAAAGGCTTGGCTTGCTTCGAGAAGATGAAAACTCACTAC
AAAATTGACCCGATGATTGAACACTATGCGTGTGTGGTCGATTTGCTGTCCCGGTCACAGAAGATTTCAAAAGCCGAAGA
ATTTATCCAAGCAATGCCAATAGAACCTGATGCAAGCATATGGGCATCTGTGCTAAGAGCTTGTAGAACAAGTGGGGACA
TGGAGACCGCAGAAAGAGTATCTAGGAGGATCATTGAACTGAATCCGGATGATCCAGGTTACTCGATTCTAGCATCAAAC
GCATATGCAGCCTTGAGAAAATGGGACAAAGTAAGTCTAATCCGCAAATCCGTGAGAGATAAACACATCAAGAAGAATCC
TGGATATAGTTGGATTGAAATCGGTAAAAAAGTTCACGTGTTCTGCTCAGGAGATGATTCAGCTCCTCAGTCGGAAGCCA
TTCACAAGTCACTAGAGATACTTTACAGTCTGATGGCTAAAGAAGGGTACATTCCCGATTCAAGGGAAGTGTCACAGAAT
CTAGAGGAAGAAGAAGAGAAGAGACGTTTGATCTGTGGGCACAGCGAGAGACTAGCTATTGCGTTTGGACTGTTGAACAC
AGAACCAGGGACTCCATTGCAGGTGATGAAGAACCTTCGTGTTTGTAGTGATTGTCATGAAGTCACAAAGTTGATATCGA
AGATCGTGGGACGTGAGATATTAGTGCGGGATGCTAATCGATTCCATCTCTTTAAAGATGGCATTTGTAGCTGCAAAGAT
CGGTGGTGA