Details for Lyrate rockcress Locus 16061993

Position : sca3 ( 5`- 8064411 .. 8062008 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16061993

Protein [Map View]
MSSSHNRSNKNSEGAKAEQIIFEFFAKSLHIILESRTPFMSSRNFSGDQMICSPSSSSSSSSSVRPRDKWFNLALRECPA
ALESFDIGRRSSLEPLVVDVVLVVRPLVGDQMNLSGKRELIRNFSGKDYQSGWNSDQDELGCEAKNEQIIERWVVQYDNR
KIRESVTTSSRRSSSNKLQVMYKKATLLLRSLFVMVRLLPAYKIFRELNSSGQIFKFKLVPRVPSIVEPFTRREEAEMQK
FSFTPVETICGRLCLSVLYRSLSDVSCEHSTPMSPTFITDYVGSPLADPLKRFPSLPLSYGSPPLLPFQRRHSWSFDRYK
ASPPSVSCSPSPTRSDSHALVSHPCSRHLPPHPSDIPTGRRKECYAEGYPPSQDFSPPPSPSAPKHAVPRGITRTESAPV
RIPAPTFQSKENVVAPSGHLKLSRHPSLKPVRNLGPGESGGAIDKLFLYGRDDFRRNSGVRPSSNSSPRISFSRSSSRSF
QDDFDDPDFPCPFDVEYDDIADRNSRPGSFDHRGDIHEPLDSSGSYPKKSQDAEVGALVRMLKKAPPLRQDVSESSIPEI
CWNNNNSNKPAGAHEIAVASITASGITLASKTTADALEELRSYKEMKNHLLLSQSTSNPSSVTTSPFEV*

DNA
ATGTCATCTTCACACAACAGGAGTAACAAAAATTCAGAAGGTGCTAAAGCTGAACAAATCATATTTGAGTTCTTTGCTAA
AAGCCTTCACATCATTCTCGAGTCAAGGACTCCTTTTATGTCTTCAAGGAATTTTAGTGGTGACCAGATGATTTGTTCTC
CTTCCTCATCTTCTTCCTCTTCCTCCAGTGTCAGGCCTCGCGACAAATGGTTCAATCTAGCTCTTAGGGAATGCCCTGCA
GCGTTAGAGAGTTTTGATATCGGGAGGAGAAGCAGTCTTGAGCCTTTGGTTGTTGATGTGGTTCTTGTGGTGAGGCCACT
TGTTGGTGATCAGATGAACTTGTCTGGTAAAAGGGAGCTTATCAGGAATTTTTCCGGGAAAGATTATCAGTCGGGTTGGA
ATTCTGATCAAGATGAATTGGGATGTGAAGCTAAGAACGAGCAGATTATTGAGAGATGGGTGGTGCAGTATGATAATAGG
AAGATCAGGGAATCTGTTACTACCAGTAGCAGGAGGTCAAGCAGTAATAAGTTGCAAGTCATGTATAAGAAAGCTACTCT
GCTGCTAAGATCATTGTTTGTGATGGTTAGGCTTTTACCTGCTTATAAGATTTTCCGGGAACTTAATTCCTCGGGGCAGA
TCTTCAAGTTCAAGCTTGTTCCCAGGGTTCCCTCTATTGTTGAGCCATTCACTCGTAGAGAAGAGGCAGAAATGCAGAAG
TTTTCTTTCACACCGGTTGAAACTATCTGTGGTAGACTTTGCTTATCGGTTTTATATCGTTCTCTTTCCGATGTCAGTTG
CGAACACTCAACTCCTATGTCTCCAACATTTATAACCGATTATGTTGGAAGTCCCTTGGCTGATCCTTTAAAGAGGTTCC
CTTCCCTTCCTCTTTCATATGGTTCTCCTCCATTGCTGCCATTTCAAAGGCGGCATAGCTGGAGTTTCGATCGTTACAAA
GCATCTCCACCTTCTGTTTCTTGCTCACCATCGCCTACACGCTCGGATTCACATGCATTGGTTTCACATCCTTGCTCCCG
TCACCTTCCTCCTCACCCTTCTGATATACCCACTGGTCGTAGGAAGGAATGCTATGCTGAAGGATATCCTCCTTCTCAAG
ATTTCTCCCCTCCTCCTTCTCCTTCAGCCCCAAAACACGCCGTCCCAAGAGGCATCACGCGTACTGAAAGTGCTCCAGTC
AGAATCCCAGCTCCAACTTTCCAGTCCAAAGAAAACGTTGTGGCACCTTCTGGTCATCTGAAATTGTCGAGACACCCTTC
GTTGAAGCCTGTGAGAAACTTGGGTCCTGGTGAATCTGGAGGAGCAATAGATAAGCTGTTTCTTTATGGGAGAGATGACT
TTAGAAGAAATTCTGGGGTGAGGCCGTCTTCCAACAGCTCACCGCGGATATCATTTTCCCGGAGTTCCAGTAGATCTTTC
CAAGACGATTTTGATGATCCTGATTTCCCTTGCCCATTTGATGTTGAGTATGATGATATCGCAGATCGTAATAGCAGACC
AGGGTCGTTCGACCACAGAGGAGACATACATGAACCACTCGATTCAAGTGGGTCATACCCGAAGAAGTCCCAAGATGCTG
AAGTTGGTGCCCTTGTGAGAATGCTGAAGAAAGCTCCTCCTCTCAGACAAGATGTCTCTGAATCTTCGATACCTGAAATT
TGCTGGAACAACAACAACAGCAACAAACCCGCAGGGGCTCACGAGATAGCAGTAGCGTCTATCACAGCCTCGGGGATTAC
TCTGGCCTCAAAGACAACAGCTGATGCATTGGAAGAGTTGAGGTCTTACAAAGAAATGAAGAATCATTTGTTGCTTAGTC
AATCCACATCAAACCCTTCCTCGGTTACTACTTCACCTTTTGAAGTTTGA