Details for Lyrate rockcress Locus 16061937

Position : sca3 ( 5`- 6602877 .. 6602173 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16061937

Protein [Map View]
MASNQQSYKAGETRGKAQEKTGQAMGTMRDKAEEGREKTSQTAQTAQQKAHETAQSAKDKASQTAQTAQQKAHDTTQAAK
DKASQTGDKAREAKDKTGSYMSETGEAIKNKAQDAAQYTKETAQGAAQYTKETAEAGRDKTGGFLSQTGEHVKQMAMGAA
DAVKHTFGMATDEEEDKEHFPGSTTTTTASTRTTDPTHQTYQRK*

DNA
ATGGCGTCCAACCAACAGAGCTACAAGGCTGGTGAAACCAGAGGCAAGGCCCAGGAGAAGACTGGACAAGCTATGGGAAC
GATGAGGGACAAGGCTGAGGAGGGCAGGGAAAAGACTTCTCAAACGGCCCAAACAGCCCAACAAAAGGCCCATGAGACAG
CCCAGTCAGCTAAAGATAAGGCATCTCAAACTGCCCAAACGGCTCAGCAGAAGGCCCATGATACGACTCAAGCAGCAAAA
GACAAGGCATCTCAAACTGGCGACAAAGCTCGCGAGGCCAAGGACAAGACCGGGAGTTACATGTCGGAAACAGGCGAAGC
CATAAAGAACAAGGCTCAAGACGCTGCTCAGTACACAAAGGAGACGGCTCAAGGTGCGGCTCAGTACACAAAGGAGACAG
CTGAAGCTGGTAGAGACAAGACCGGTGGGTTTTTGAGCCAGACCGGTGAGCATGTTAAGCAAATGGCTATGGGTGCAGCT
GACGCAGTGAAGCATACTTTTGGGATGGCTACTGATGAGGAAGAAGACAAAGAGCATTTTCCAGGAAGTACTACGACCAC
TACTGCAAGTACCCGGACCACTGATCCGACTCATCAGACTTACCAGAGGAAGTGA