Details for Lyrate rockcress Locus 16061929

Position : sca3 ( 5`- 1054809 .. 1057664 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16061929

Protein [Map View]
MDLAGETNSLISTVASFSSSSSSVSSIDTSLDCDSPRGGDVDHELLHTAVSPSVSVSISSSSSASIQRVLSLIRSKDLDS
RLFAAKEIRRLTKTSHRCRRHFSQAVEPLVSMLRFDSPESHHEAALLALLNLAVKDEKNKVSIIEAGALEPIINFLQSNS
PTLQEYASASLLTLSASANNKPIIGANGVIPLLVKVIKHGSPQAKADAVMALSNLSTLPDNLSMILATKPLSPILNLLKS
SKKSSKTSEKCCSLIESLIVSGEDARTGLVSDEGGVLAVVEVLENGSLQAREHAVGVLLTLCQSDRSKYREPILREGVIP
GLLELTVQGTSKSRTKAQRLLCLLRDSESPRSEVQPDTIENIVSSLISHIDGDDQSGKAKKMLAEMVQVSMEKSLRHLQE
RASTLVRP*

DNA
ATGGACCTCGCCGGAGAAACAAACAGCCTTATCTCCACCGTCGCTTCTTTTTCTTCTTCTTCTTCCTCCGTTTCATCAAT
CGACACAAGCCTCGATTGCGATTCGCCACGTGGCGGAGATGTAGACCACGAATTGCTCCACACGGCGGTTTCTCCGTCGG
TGTCGGTTTCGATTTCTTCGTCTTCTTCTGCTTCAATCCAGAGAGTACTAAGTTTAATCAGATCAAAGGATCTCGATTCG
AGGTTGTTTGCCGCTAAAGAGATCCGTCGGCTGACAAAGACGTCTCATAGGTGCCGCCGACACTTTTCCCAAGCCGTGGA
ACCGCTCGTTTCTATGCTCCGATTTGATTCGCCTGAATCTCACCATGAAGCTGCTTTACTTGCTCTCCTTAACCTCGCCG
TCAAAGACGAAAAGAATAAAGTGAGTATAATTGAAGCTGGTGCTTTAGAGCCAATCATCAACTTCTTACAATCAAATAGC
CCAACACTTCAAGAGTATGCTTCTGCATCTTTGCTCACTCTCTCCGCGTCAGCAAACAACAAACCCATCATTGGAGCTAA
TGGCGTGATTCCTTTATTAGTCAAAGTCATTAAACATGGAAGCCCACAAGCTAAAGCTGATGCAGTAATGGCCCTTTCCA
ACCTCTCTACACTCCCCGATAACCTAAGCATGATCCTAGCGACTAAACCACTCTCACCAATACTGAATCTTCTCAAATCA
AGTAAAAAGTCATCGAAAACATCTGAGAAATGTTGTTCTCTGATAGAATCCTTGATAGTTTCTGGTGAGGATGCGAGAAC
AGGGTTAGTTTCAGATGAAGGAGGAGTTTTAGCGGTCGTGGAAGTTCTTGAAAACGGGTCATTACAAGCTCGGGAACATG
CGGTTGGCGTGCTTTTAACGCTCTGCCAAAGTGATAGGAGTAAATACAGAGAGCCAATTCTTAGAGAAGGTGTGATACCG
GGACTGCTTGAGCTCACGGTTCAAGGGACATCAAAATCTCGGACTAAAGCTCAGAGACTTCTCTGTTTACTAAGGGACTC
AGAAAGCCCGAGATCAGAGGTTCAACCCGATACAATAGAAAACATAGTGTCAAGCTTAATCTCTCATATAGACGGAGATG
ATCAATCCGGTAAGGCAAAGAAGATGCTAGCTGAAATGGTGCAAGTTAGCATGGAAAAAAGCTTGAGACATCTACAAGAA
CGTGCTTCGACTCTTGTCCGTCCATAA