Details for Lyrate rockcress Locus 16061899

Position : sca3 ( 5`- 1493787 .. 1496180 -3` )
Annotation : [B2G] peroxin-12 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16061899

Protein [Map View]
MLFQVGGEGTRPTFFEMAAAQQLPASLRAALTYSLGVFALRRSFLHKILDYEDEFFAALMLILEGHSLRTTDASFAESLY
GLRRKSVRLRLRKDSVRKDSGEEVQHSGLEKRQRILSVVFLVVLPYFKSKLHAIYNKEREARLRESLWGAEDQGFDEADF
FTGDDSIVSREPSGNEELSVRVQLATKIKKFIAVCYPWIHASSEGLSFTYQLLYLLDATGFYSLGLQALGIQVCRATGQE
LMDTSSRISKIRNHERERLRGPPWLKTVQGALLSCSYAVLDYAQTGLIAAVFIFKMMEWWYQSAEERLSAPTVYPPPPPP
PAPKMAKEGIPLPPNRSLCALCLQKRANPSVVTVSGFVFCYSCVFKYVSKYKRCPVTLIPASVDQIRRLFHDT*

DNA
ATGTTGTTTCAGGTGGGAGGTGAAGGCACACGCCCCACCTTCTTTGAGATGGCTGCTGCTCAGCAACTTCCGGCTAGCCT
TCGCGCCGCTCTCACTTATTCCCTCGGCGTTTTTGCTTTGAGACGATCATTTCTCCATAAGATTTTAGACTATGAGGATG
AATTCTTTGCTGCTCTGATGCTTATTCTTGAAGGACACAGCTTACGAACCACAGATGCTTCCTTTGCTGAATCATTGTAT
GGGTTGAGGAGGAAATCGGTGAGATTGAGATTGAGGAAAGACAGTGTCAGGAAGGATTCCGGCGAAGAAGTTCAACATTC
TGGTTTAGAGAAGCGCCAGAGAATCCTTTCTGTTGTGTTTCTGGTTGTGTTGCCGTATTTCAAGTCCAAATTGCATGCTA
TCTATAATAAAGAAAGAGAAGCTAGGCTCCGGGAAAGTTTATGGGGAGCAGAGGATCAAGGATTTGATGAAGCTGACTTC
TTTACTGGGGATGATTCAATTGTTTCAAGAGAGCCTAGTGGGAATGAAGAGCTTTCTGTTCGAGTACAATTAGCTACCAA
AATAAAAAAGTTTATAGCTGTCTGCTATCCTTGGATACATGCATCAAGTGAAGGATTATCGTTCACTTACCAGCTCTTAT
ATCTGCTGGACGCTACTGGATTTTATTCTCTTGGGTTACAAGCTCTTGGGATTCAAGTTTGTCGAGCTACAGGGCAAGAA
CTGATGGATACATCCTCAAGAATTTCAAAGATACGGAATCATGAGCGTGAGAGACTTCGTGGTCCTCCGTGGTTAAAAAC
AGTGCAAGGGGCACTTCTTAGCTGCTCATATGCGGTGCTTGACTACGCCCAAACCGGTCTTATTGCAGCAGTTTTTATCT
TTAAAATGATGGAATGGTGGTATCAATCAGCTGAAGAGAGATTATCAGCTCCAACAGTGTACCCTCCACCTCCACCTCCT
CCAGCCCCAAAGATGGCGAAAGAAGGAATCCCTCTACCTCCCAACAGATCCCTCTGCGCGCTATGCTTGCAAAAACGTGC
AAACCCATCAGTTGTCACAGTCTCTGGATTTGTTTTCTGCTACTCATGCGTATTTAAGTATGTTTCAAAGTACAAGCGAT
GTCCGGTGACATTGATTCCGGCCAGCGTGGATCAGATTAGGAGGTTGTTTCATGACACTTAA