Details for Lyrate rockcress Locus 16061879

Position : sca3 ( 5`- 921788 .. 920004 -3` )
Annotation : [B2G] nadh:ubiquinone oxidoreductase family protein
External links : CoGe
PGDD synteny : 16061879

Protein [Map View]
MALTVAKSALEAIREKGLGGLMRMIREEGFLRCLPDGNLLQTKIHNIGATLVGVDKFGNKYYQKLGDTQYGRHRWVEYAS
KDRYNASQVPAEWHGWLHFITDHTGDELLSLKPKRYGLEHKENFSGEGDAYIYHSKGHTLNPGQKNWTRYQSWVPTKTQ*

DNA
ATGGCTTTGACGGTGGCGAAGAGTGCGTTGGAGGCGATTAGAGAGAAAGGTCTCGGCGGTTTAATGAGGATGATCCGAGA
AGAAGGCTTCCTGAGATGCCTACCAGATGGGAACCTTTTGCAAACTAAAATACACAACATAGGAGCAACACTTGTTGGTG
TTGACAAGTTCGGTAACAAATACTACCAGAAGCTGGGCGATACTCAATACGGTAGGCACAGATGGGTAGAGTATGCTTCA
AAGGATCGTTACAATGCATCTCAAGTGCCAGCTGAATGGCACGGGTGGCTTCATTTCATCACTGATCACACTGGAGATGA
GCTCTTGAGTTTGAAACCAAAAAGGTATGGGCTTGAGCATAAAGAGAACTTCTCTGGAGAAGGTGATGCATACATCTACC
ATTCGAAGGGACATACCTTGAACCCGGGACAAAAGAACTGGACTCGGTACCAATCATGGGTACCCACCAAGACTCAGTAA