Details for Lyrate rockcress Locus 16061867

Position : sca3 ( 5`- 8866012 .. 8864066 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16061867

Protein [Map View]
MADIDIGTAATTGGNDGRGTRERLINRETKFTRSVSHAQDELQSFRKYLRWMCVDQSSPWTAVLSWSMFVVFTLVVPATS
HFMLACADCDSHHSRPYDSVVQLSLSSFAALSFLCLSRFVSKYGLRRFLFFDKLWDESETVRRGYTNQLNRSLKILSYFV
TPCFLAMSSYKIWWYASGASQIPFLGNVILSDTVACLMELCSWLYRTTVIFLVCVLFRLICHLQILRLQDFAQVFQMDSD
VGSILSEHLRIRRHLRIISHRYRTFILLSLILVTGSQFYSLLITTKAYAELNIYRAGELALCSMTLVTALLILLRSASKI
THKAQAVTCLAAKWHVCATIESFETVDGETPRLVDRASGHGYYPTDDDNGESDSEDYGDEEDDFDNNNLIPAYAYSTISF
QKRQALVNYFENNRAGITVFGFTLDRSTLHTIFGIEMSLVLWLLGKTIGIS*

DNA
ATGGCGGACATCGACATCGGGACCGCAGCAACAACAGGAGGAAACGACGGAAGAGGAACACGAGAACGTCTAATAAACCG
AGAAACCAAGTTCACACGTAGCGTATCTCACGCACAAGACGAGCTCCAGAGTTTCCGGAAATATCTGCGATGGATGTGCG
TGGATCAGTCGAGTCCTTGGACCGCGGTTCTCTCTTGGTCTATGTTTGTTGTTTTCACGCTCGTTGTTCCTGCCACGTCT
CACTTCATGCTCGCTTGTGCTGACTGCGATAGCCATCACTCGAGGCCGTACGATTCCGTTGTCCAGCTTTCTCTTAGCAG
TTTCGCTGCTCTTTCGTTTCTATGTCTCTCCAGATTCGTTAGCAAGTATGGTCTCCGACGGTTTCTGTTCTTTGATAAGC
TTTGGGATGAGAGCGAGACGGTTCGTCGAGGCTACACCAATCAGCTCAATAGATCGCTTAAGATTCTATCCTACTTCGTC
ACTCCTTGTTTCTTAGCGATGAGCTCTTATAAGATATGGTGGTATGCTTCAGGAGCTTCTCAGATTCCTTTCCTTGGTAA
TGTTATCTTGAGTGATACAGTCGCTTGTCTGATGGAACTCTGCTCGTGGCTGTACCGTACTACCGTGATCTTTCTGGTTT
GCGTCCTCTTTCGTCTCATCTGTCATCTCCAGATTCTTAGGCTGCAAGACTTTGCTCAGGTTTTCCAGATGGATTCTGAT
GTTGGTTCTATCTTGTCTGAACATCTCCGCATCAGACGTCATCTGAGAATCATCAGCCACAGATACCGAACCTTTATATT
GTTGTCCTTGATTCTTGTCACTGGAAGTCAGTTTTACTCTCTGCTTATTACCACTAAGGCCTACGCTGAATTGAATATCT
ACAGAGCAGGAGAACTAGCACTATGTTCAATGACGCTGGTCACCGCACTGCTCATTCTACTACGAAGTGCCTCAAAGATC
ACACACAAGGCTCAGGCGGTGACTTGTCTTGCAGCCAAGTGGCATGTTTGTGCGACAATAGAATCCTTTGAGACAGTGGA
TGGAGAGACTCCAAGGTTAGTTGATAGAGCAAGCGGACACGGATACTATCCAACAGATGATGATAATGGAGAATCAGACA
GTGAAGATTATGGAGACGAAGAAGATGATTTCGATAACAACAATCTCATTCCTGCTTATGCTTATAGCACCATATCATTC
CAAAAACGGCAAGCTCTAGTTAATTACTTTGAGAACAATAGAGCAGGAATCACGGTGTTTGGGTTTACACTTGATAGAAG
TACTCTCCATACAATCTTCGGTATCGAAATGTCGCTTGTTCTCTGGTTACTTGGTAAGACCATTGGAATTTCTTGA