Details for Lyrate rockcress Locus 16061838

Position : sca3 ( 5`- 11060083 .. 11058467 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16061838

Protein [Map View]
MVSKPLHSFIVILLVLSAGDKTAAVNEPELEMEPVPAVWPEQFHALMLMNKSGALEIVDLWYDWVNGRNFNIIQKQLGKL
TYDLEWNNGTSFYYTLDASRTCRTVHFEVGILRPNWLDGAKYLGQRHVNGFLCNVWEKVEFLWYYEDIVTKRPVQWIFYT
GREAHVMTFDVGAVLEDEKWQAPVYCFHNEKKEVQ*

DNA
ATGGTCTCAAAACCACTCCACTCCTTCATCGTTATCCTCCTCGTCCTCTCCGCCGGTGACAAAACAGCCGCCGTTAATGA
GCCGGAGCTGGAGATGGAGCCGGTTCCGGCGGTATGGCCGGAGCAGTTCCACGCGTTGATGTTGATGAACAAATCTGGAG
CCTTGGAGATTGTGGATCTTTGGTACGACTGGGTCAATGGACGTAACTTTAACATCATTCAGAAGCAACTTGGTAAACTC
ACTTATGACCTCGAATGGAACAATGGCACTTCTTTCTACTACACTCTCGACGCTTCTAGAACTTGTCGCACCGTTCACTT
TGAGGTTGGAATCTTGAGGCCAAATTGGCTAGATGGAGCAAAGTATTTGGGTCAACGACATGTAAATGGTTTTTTATGCA
ACGTATGGGAGAAAGTTGAGTTCTTATGGTACTATGAAGATATTGTCACCAAGAGACCTGTACAATGGATCTTCTATACA
GGTAGAGAAGCTCATGTGATGACATTTGATGTTGGAGCTGTCCTAGAAGACGAGAAATGGCAGGCTCCTGTCTATTGTTT
CCACAATGAGAAAAAAGAAGTACAATGA