Details for Lyrate rockcress Locus 16061774

Position : sca3 ( 5`- 3869243 .. 3867740 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478299 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16061774

Protein [Map View]
MGNISSSGGEGRRRRRRNHTAAPPPPPPPSSSLPPPPPATEIQANPIVFAAVTPYPNPNPNPVYQYPASYIHHPPPGTMS
GPPLPPYDHHLHHPYHNHSWAPVAMARYSFAGHMMAPPTPYVEHQKAVTIRNDVNLKKETLRLEPDPDNPGRFLVSFTFD
ATVSGRISVIFFAKESEDCNLTATKEDILPPITLDFEKGLGQKFKQSSGSGIDFSVFEDVELFEAANTDIYPLAVKAEAA
PSGENEEERLGSKKKNAQITQAVYEKDKGEIKIRVVKQILWVNGTRYELQEIYGIGNTVEGDEDSADDANDPGKECVICL
SEPRDTTVLPCRHMCMCSGCAKVLRFQTNRCPICRQPVERLLEIKVHGNSGSGNNTGQGETVEPE*

DNA
ATGGGAAACATTAGCAGCAGCGGTGGTGAAGGTAGACGCCGTCGACGGCGAAACCATACGGCGGCTCCACCACCACCACC
TCCTCCTTCTTCTTCTCTTCCTCCACCACCTCCAGCTACAGAAATCCAAGCTAATCCCATCGTTTTCGCCGCCGTTACTC
CGTATCCAAATCCTAATCCTAATCCGGTTTACCAGTACCCTGCTTCTTACATCCACCATCCTCCGCCGGGAACCATGTCG
GGTCCACCTCTTCCGCCGTACGACCACCACCTCCATCATCCTTACCACAACCACTCTTGGGCCCCCGTGGCGATGGCCAG
ATACTCTTTTGCTGGTCACATGATGGCTCCCCCGACTCCTTACGTTGAACACCAGAAAGCCGTCACGATTCGTAACGACG
TTAATCTTAAGAAGGAGACTCTCAGGCTTGAACCCGACCCCGATAATCCGGGTCGGTTTCTCGTCTCCTTCACGTTTGAT
GCAACCGTCTCCGGAAGGATTAGTGTCATTTTCTTTGCTAAAGAATCCGAAGATTGCAATCTCACAGCGACCAAGGAAGA
TATTCTGCCACCAATCACCCTAGATTTCGAGAAAGGACTTGGTCAGAAGTTTAAACAATCATCTGGTTCTGGTATAGACT
TTTCTGTCTTTGAGGACGTTGAGCTGTTCGAGGCGGCGAACACAGATATCTATCCATTGGCGGTTAAGGCAGAAGCAGCT
CCCTCAGGTGAGAATGAAGAAGAAAGGTTGGGATCAAAGAAAAAGAATGCGCAGATTACTCAAGCGGTTTATGAGAAGGA
TAAAGGAGAGATTAAGATTAGAGTGGTGAAGCAGATACTGTGGGTTAATGGAACAAGATATGAGTTGCAGGAGATTTATG
GGATTGGGAATACCGTTGAGGGCGATGAGGATTCAGCTGATGATGCTAATGATCCGGGAAAAGAATGTGTGATATGTTTG
TCTGAACCACGAGACACTACTGTTCTTCCATGTAGACATATGTGTATGTGCAGCGGATGCGCTAAGGTATTGAGGTTTCA
AACGAATCGATGCCCAATTTGCAGGCAACCTGTCGAAAGGCTTTTGGAGATAAAAGTTCACGGTAACAGCGGAAGTGGGA
ACAACACCGGACAGGGTGAAACAGTTGAACCAGAATAG