Details for Lyrate rockcress Locus 16061753

Position : sca5 ( 5`- 18007228 .. 18009597 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_907112 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16061753

Protein [Map View]
MEAKPKRRIVTENGDTGEDLVLATLIGNGDDVGPLVRHAFEMGRPEPLVHQLKNVARKKEAEIEDLCKTHYEEFIVAVDE
LRGVLVDAEELKSDLASDNFRLQEVGSALLVKLEELLESYAIKKNVTEAIKMSKICVQALELCVKCNSYISEGQFYHALK
TMDLIERSYLKLIPLKVLKLVIERRIPVIKTHIEKKVCSQFNEWLVHIRSSSKNIGQTAIGLTASARQREEEMLERQRRA
EEQNTGGLGELAYTLDVEDSEQDSVLKFDLTPLYRAYHIHTILGVPERFRDYYYENRLLQLQSDLQISYTQPFVESYQTF
LAQVAGYFIVEDRVIRTAGDFLLADQVETMWETAISKIVAILENQFARMDSPTHLLLVKDYVTLLGTTLRQYGYEVGPVL
DALDKSRDKYHELLLEECRKQIVTAITEDTYQQMVIKKEADYENNVLSFNLQTSDIMPAFTYIAPFSSMVPDVCRIIRSY
IKGSVDYLSYGVNTNFFSVLRKYLDKILIDVLNEVILETISNNSIGVSQAMQIAANISFLEKASDYFLRHAAQLCGIPSR
SVERPQASLAAKVVLKTSRDAAYLALLNVVNTKLDEFMKLTENVNWTTEEMPQGPHEYINEVVIYLETVMSTAQQILPMD
ALYKVGVGAIEHISNSLVSTFLSDSIKRFNANAVSAINHDLRVIENFADERYHSSGLNEIYKEGSFRSYLVEARQLINLL
SSSQPENFMNPVIRERNYNTLDYKKVATICEKFKDSADGIFGSLANRNTKLTAKKKSMDMLKKRLKEFN*

DNA
ATGGAGGCCAAACCAAAAAGGAGGATTGTTACAGAGAATGGAGATACAGGGGAGGATTTAGTTCTTGCTACATTGATTGG
AAACGGAGATGATGTGGGTCCTCTTGTTAGGCATGCTTTTGAAATGGGGCGGCCTGAGCCTCTCGTTCATCAGCTCAAAA
ACGTGGCGAGGAAGAAGGAAGCTGAAATCGAGGATCTATGCAAGACCCACTATGAAGAATTCATTGTTGCGGTTGATGAG
CTCCGTGGTGTGCTAGTTGACGCTGAAGAGCTTAAGAGTGACCTTGCAAGTGACAATTTCCGCTTGCAAGAAGTTGGTAG
TGCCTTATTGGTAAAGCTGGAAGAGCTTCTCGAGTCTTATGCAATCAAGAAGAATGTAACCGAAGCTATTAAAATGTCAA
AGATCTGCGTTCAAGCGCTGGAGTTGTGTGTTAAATGTAATAGTTACATATCTGAAGGCCAGTTTTACCATGCCCTGAAA
ACCATGGATTTGATTGAGAGGAGTTACCTGAAGCTTATCCCACTTAAGGTTCTAAAGTTGGTTATAGAGAGAAGAATTCC
AGTGATCAAGACACACATTGAGAAAAAAGTGTGCAGCCAATTTAATGAATGGCTTGTTCACATTAGGAGTTCCTCAAAAA
ATATTGGACAGACTGCTATTGGCCTCACCGCTTCAGCTCGCCAGAGGGAAGAAGAAATGCTGGAACGTCAGAGGAGAGCA
GAGGAACAAAACACTGGGGGTTTGGGAGAATTGGCATACACTTTAGATGTTGAAGATTCGGAACAAGATTCTGTTTTAAA
GTTTGATCTCACACCTCTGTATCGAGCTTATCACATCCACACTATTCTTGGAGTCCCAGAACGATTTCGTGACTATTACT
ATGAGAATAGGCTACTGCAGCTCCAATCAGATCTGCAGATCTCTTATACACAGCCATTTGTGGAATCATACCAAACATTT
CTAGCCCAGGTTGCAGGATATTTCATTGTGGAGGATCGGGTGATTAGGACAGCTGGAGATTTCTTATTGGCGGATCAAGT
TGAGACAATGTGGGAAACAGCCATTTCCAAAATTGTAGCGATATTGGAGAACCAATTTGCCAGAATGGATTCGCCTACTC
ATCTGCTTTTGGTGAAAGATTATGTAACTCTCCTTGGCACAACCCTTAGACAGTACGGTTATGAAGTGGGTCCAGTTCTT
GATGCCCTTGACAAGAGCCGAGATAAATACCACGAGCTTCTTCTTGAAGAGTGTCGAAAGCAAATCGTGACTGCTATTAC
AGAGGACACTTATCAGCAGATGGTAATCAAGAAGGAAGCTGACTATGAAAACAATGTCTTGTCGTTTAATCTTCAGACCT
CAGACATTATGCCGGCTTTCACTTACATTGCGCCGTTCTCTTCTATGGTGCCAGATGTTTGCCGCATCATCAGGTCATAC
ATAAAAGGATCTGTTGATTACTTGTCATATGGAGTGAACACTAACTTTTTCAGTGTTCTGAGGAAGTACCTTGACAAAAT
CTTGATTGATGTATTGAACGAAGTTATCCTCGAGACGATTAGCAACAATTCAATTGGTGTATCTCAAGCTATGCAGATTG
CAGCGAACATATCTTTCCTCGAAAAGGCCAGTGACTATTTTCTCCGGCATGCAGCTCAACTTTGTGGCATCCCAAGCCGA
TCAGTTGAGAGGCCTCAAGCTAGTTTAGCTGCAAAGGTTGTCCTCAAAACATCAAGAGACGCAGCCTATCTTGCTTTGTT
GAATGTGGTTAACACCAAGTTGGACGAGTTCATGAAACTCACAGAAAACGTAAACTGGACTACAGAGGAAATGCCACAAG
GGCCGCACGAGTACATAAACGAGGTTGTTATATACCTCGAGACTGTAATGTCAACGGCACAACAGATCCTCCCAATGGAT
GCCTTATACAAAGTTGGAGTTGGGGCTATCGAGCATATCTCAAACTCCCTCGTCTCTACATTCCTCAGCGATAGCATCAA
GAGATTCAATGCTAATGCAGTCTCGGCCATTAACCACGATCTGAGAGTGATAGAAAACTTTGCTGATGAGAGATATCACT
CAAGTGGGTTAAACGAGATCTACAAAGAAGGAAGCTTTAGAAGCTATCTAGTTGAAGCTAGGCAGCTGATAAACCTGTTG
TCGAGTAGCCAACCCGAGAACTTCATGAACCCGGTGATTAGAGAGAGGAACTACAACACTTTGGATTACAAAAAAGTGGC
TACGATCTGCGAGAAGTTTAAGGATTCTGCAGACGGGATATTCGGAAGCCTGGCAAATAGAAACACAAAGCTGACAGCTA
AAAAGAAATCGATGGACATGCTCAAGAAGAGACTCAAGGAATTTAACTGA