Details for Lyrate rockcress Locus 16061714

Position : sca3 ( 5`- 3196309 .. 3197170 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16061714

Protein [Map View]
MKLVRFLMKLNNETVSIELKNGTVVHGTITGVDVSMNTHLKTVKMSLKGKNPVTIDHLSLRGNNIRYYILPDSLNLETLL
VEDTPRVKPKKPVAGECTELCI*

DNA
ATGAAGCTCGTCAGGTTTTTGATGAAGTTAAACAATGAAACTGTGTCAATCGAGCTGAAGAATGGGACTGTGGTCCATGG
AACCATCACTGGTGTTGATGTGAGCATGAACACTCACTTGAAGACAGTGAAAATGAGCCTCAAGGGGAAAAACCCAGTAA
CTATTGATCATCTTAGCTTGAGGGGTAACAATATCCGCTACTACATTCTTCCTGATAGCTTGAACCTCGAGACTTTACTT
GTGGAAGACACTCCTAGAGTTAAACCTAAGAAGCCTGTTGCTGGAGAATGTACCGAGTTATGTATCTAG