Details for Lyrate rockcress Locus 16061690

Position : sca3 ( 5`- 2024120 .. 2022729 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477828 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16061690

Protein [Map View]
MGRACLPRWRLGRLMAGLQVILGLLVITVSLSCLFRFHSAGYFLHNEDVCNNIYTIKEVSNEGFDIKALHDRVDEVLEKM
DNLYEKLEKTVKEMEKSKDGSKKEMKKFLEDEVMKPFYYAHIGLRQIRLPKPEGIRNSTEKEEPLINKFLIEEIRQYITP
KENRVGKINMFGTERVYNTIGHACALMKIELEKYMDYDVGAYCDDDWNLAQKLMLNGCDPLPRRRCLTRASMTYQKPYPI
NESLWKLPDDRNVRWGNYQCRNFACLSSKNPKRGYTKCSGCFEMEKEGDKWVKNSTLLVDFMIEDVLRVKPGEIRLGLDY
GVGTGTFAARMREKNVTIVTTALNLGAPFNEMIALRGLIPLYLSLNQRLPFFDNTMDMIHTAGLMDGWIDLLLMDFVLYD
WDRVLRPGGLLWIDRFFCKKKDLDDYMYMFLQFRYKKHKWAVSPKSKDEVYLSALLEKPPRAI*

DNA
ATGGGAAGAGCATGTTTACCGAGATGGCGATTAGGAAGACTAATGGCAGGATTACAAGTAATCTTGGGATTACTGGTGAT
CACTGTGAGCCTCTCATGTCTCTTCCGATTCCATTCCGCTGGTTACTTCTTGCACAACGAAGACGTTTGCAACAATATCT
ACACAATCAAAGAAGTCAGCAACGAAGGATTCGACATAAAGGCGCTACATGATCGCGTTGATGAAGTACTAGAAAAGATG
GACAACTTGTACGAGAAGCTTGAGAAGACGGTAAAAGAGATGGAGAAGAGCAAAGACGGAAGCAAAAAGGAGATGAAGAA
GTTTCTTGAAGATGAAGTGATGAAGCCATTTTATTATGCTCATATCGGATTAAGGCAAATCCGGTTACCAAAACCCGAAG
GAATCAGAAACTCGACGGAAAAGGAAGAGCCTTTGATCAATAAGTTTCTCATTGAGGAGATAAGGCAGTACATTACACCC
AAGGAGAATCGGGTTGGGAAGATAAACATGTTTGGAACAGAGAGAGTTTACAACACTATTGGTCATGCTTGTGCGTTGAT
GAAGATAGAGCTAGAGAAGTATATGGATTATGACGTTGGAGCGTATTGCGATGATGATTGGAACTTAGCACAGAAGCTGA
TGCTTAACGGGTGTGATCCATTACCTAGAAGACGATGCTTGACAAGAGCATCGATGACTTACCAGAAACCTTATCCGATC
AACGAGTCTTTGTGGAAGCTTCCTGATGATAGAAATGTAAGATGGGGAAATTACCAATGCAGGAATTTCGCGTGTTTATC
AAGCAAGAACCCGAAAAGGGGTTACACGAAATGCAGTGGTTGTTTTGAAATGGAGAAAGAGGGTGATAAATGGGTCAAGA
ACAGTACTTTGTTAGTTGACTTCATGATTGAGGATGTTCTGAGAGTGAAGCCAGGTGAGATTAGGCTTGGACTGGATTAT
GGTGTTGGGACAGGGACATTTGCAGCAAGAATGAGAGAGAAGAATGTGACTATTGTCACAACTGCTTTGAATTTGGGAGC
TCCTTTCAATGAGATGATTGCTTTGAGAGGTTTGATCCCATTGTACTTATCTTTGAACCAGAGGCTACCGTTCTTCGATA
ACACAATGGATATGATTCACACTGCCGGGTTAATGGATGGTTGGATCGATCTTCTTCTGATGGATTTCGTGTTATATGAT
TGGGACCGAGTGCTGAGACCGGGTGGGTTACTGTGGATTGATAGATTCTTCTGTAAAAAGAAGGATCTTGATGATTATAT
GTACATGTTCCTGCAATTTCGGTACAAGAAACACAAGTGGGCTGTTTCACCTAAATCAAAGGATGAGGTTTATCTCTCTG
CATTGCTCGAGAAACCTCCTCGTGCAATTTAA