Details for Lyrate rockcress Locus 16061663

Position : sca3 ( 5`- 5116209 .. 5124639 -3` )
Annotation : [B2G] photoperiod-independent early flowering 1
External links : CoGe
PGDD synteny : 16061663

Protein [Map View]
MASKGGKSKPDIVMASKGGKSKPDNDSRAKRHKTLEAPKEPRRPKTHWDHVLEEMAWLSKDFESERKWKLAQAKKVALRA
SKGMLDQASREERKLKEEEQRLRKVALNISKDMKKFWMKVEKLVLYKHQLVRNEKKKKAMDKQLEFLLGQTERYSTMLAE
NLVEPYKQGQNTPSKPLLAIESKSDEERAEQIPPEINSSAGLESGSPELDEDYDLKSEDETEDDEDTIEEDEKHFTKRER
QEELEALQNEVDLPVEELLRRYTAGRVSRETSPVKDENVDNLASVSRETSPVKDENEDNLASVGQDHGEDKNNLTASEET
EGNPNVRRSNDSYGHLAISETHSHDLEPGMTTASVKSRKEDHTYDFNDELEDVDFVGATGEEKDDETTLAIEEELAKADN
EDHVEEIALLQKENEMPIEVLLARYKEDFGDKDISEDDSEYSCAQSEDSIVNSDENRQQADSDNENVDSTECKPDPEPCS
ENVEGTFHEITEDNGKDSSDKIADAAAAARSAQPTGFTYSTTKVRTKLPFLLKHSLREYQHIGLDWLVTMYEKRLNGILA
DEMGLGKTIMTIALLAHLACDKGIWGPHLIVVPTSVMLNWETEFLKWCPAFKILTYFGSAKERKLKRQGWMKLNSFHVCI
TTYRLVIQDSKMFKRKKWKYLILDEAHLIKNWKSQRWQTLLNFNSKRRILLTGTPLQNDLMELWSLMHFLMPHVFQSHQE
FKDWFCNPIAGMVEGQEKINKEVIDRLHNVLRPFLLRRLKRDVEKQLPSKHEHVIFCRLSKRQRNLYEDFIASTETQATL
NSGSFFGMISIIMQLRKVCNHPDLFEGRPIVSSFDMAGIDVQLSSTICSLLLESPFSKVDLEALGFLFTHLDFSMTSWEG
DEIKAISTPSELIKQRVNLKDDMEAIPLSLKNRKNLQGTNIFEEIRKAVFEERVKETKDRAAAIAWWNSLRCQRKPTYST
SLRTLLTIKGPLDDIHHLKANCSSYMYSSILADIVLSPIERFQQMIELVEAFTFVIPAARVPSPACWCSKSDSPVFLSPS
YKEKVTDLLSPLLSPIRPAIVRRQVYFPDRRLIQFDCGKLQELAMLLRKLKFGGHRALIFTQMTKMLDVLEAFINLYGYT
YMRLDGSTPPEERQTLMQRFNTNPKIFLFILSTRSGGVGINLVGADTVIFYDSDWNPAMDQQAQDRCHRIGQTREVHIYR
LISESTIEENILKKANQKRVLDNLVIQNGEYNTEFFKKLDPMELFSGHKTLTTKDEKETSKNCGAEIPLSNADVEAALKQ
AEDEADYMALKRVEQEEAVDNQEFTEEPVERPEDDELVNEDDIKADEPADQGLVAAGLAKEEISLLHSDIRDERAVITTS
SQEDDADVLDDVKQMAAAAADAGQAISSFENQLRPIDRYAIRFLELWDPIIVEAAMENEAGFEEKEWELDHIEKYKEEME
AEIDDGEEPLVYEKWDADFATEAYRQQVEVLAQHQLMEDLENEAREREAAEVADMDLTQNVSAHVLKPKKKKKAKKAKYK
SLKKGSLAAEAKHVKSVVKIEDSTDDDNEEFGYVSSSDSDMVTPLSRMHMKGKKRDLIVDTEEEKTSQKKAKKHKKSILN
SDIKYKQTSALLEELEPSKPSDSVVVDNELKLTNRGKTIGKKFITSMPIKRVLMIKPEKLKKGNLWSRDCVPSPDSWLPQ
EDAILCAMVHEYGPNWNLVSGTLYGMTAGGAYRGRYRHPAYCCERYRELIQRHILSASDSAVNEKNVNTGSGKALLKVTE
ENIRTLLNVAAEQPDTEMLLQKHFSCLLSSIWRTSTRTGNDQMLSLNSPIFNRQFMGSVNHTQDLARKPWQGMKVTSLSR
KLLESALQDSGTSQPDDTVSRSRLQENQPINKVGLDLTLEFPRGKDDSLTQFPPMINLSIDGSDSLNYVNEPTGEDVLKG
SRVAAENRYRNAANACIEDSFGWASNTFSANDLKSRTGTKTQSLGKHKLSGSDSAKSTKSKHRKLLAEQLEVAWVRPNDP
NLKFDFTPADREDEEQEVEENAVSEEIEMISCSQWYDPFFTSGLDDCSLASDISEIE*

DNA
ATGGCGTCTAAAGGTGGCAAATCTAAACCTGATATAGTAATGGCGTCCAAAGGTGGCAAATCTAAACCTGATAATGACTC
CAGAGCTAAACGTCACAAGACGCTCGAAGCTCCTAAAGAACCACGTCGCCCGAAAACTCACTGGGACCATGTTTTGGAGG
AGATGGCTTGGCTCTCAAAGGACTTTGAGTCTGAGAGGAAATGGAAGCTGGCGCAGGCGAAGAAGGTTGCTTTGAGGGCC
AGCAAAGGAATGCTAGATCAGGCATCTAGGGAAGAAAGGAAGCTAAAGGAAGAAGAACAGCGGCTACGGAAAGTAGCTCT
CAATATCTCTAAAGACATGAAAAAGTTTTGGATGAAAGTAGAGAAGCTGGTGCTTTACAAGCATCAGCTGGTACGCAATG
AGAAGAAGAAGAAGGCTATGGACAAGCAACTTGAATTTCTGTTAGGCCAAACTGAGAGGTACTCAACCATGTTGGCTGAA
AATTTAGTGGAGCCTTATAAACAGGGCCAAAATACTCCTTCAAAACCTCTACTAGCTATCGAATCAAAAAGTGATGAGGA
GAGGGCAGAACAGATACCTCCAGAGATAAATTCTTCTGCAGGTCTTGAATCAGGAAGTCCTGAACTCGATGAGGACTATG
ATCTAAAATCCGAGGATGAGACCGAAGATGATGAAGATACTATTGAGGAGGATGAAAAACACTTCACCAAACGGGAAAGA
CAGGAAGAGTTGGAAGCTTTGCAAAATGAAGTGGATCTACCAGTTGAGGAGCTGCTCAGACGTTATACTGCTGGAAGAGT
TAGCCGAGAAACCAGCCCAGTAAAAGATGAAAATGTGGACAATCTGGCCTCAGTTAGCCGAGAAACTAGCCCAGTAAAAG
ATGAAAATGAGGACAATCTGGCCTCAGTAGGTCAAGATCATGGAGAGGACAAGAACAATCTTACAGCTTCTGAAGAAACT
GAAGGGAACCCAAATGTTCGTCGTTCTAATGATAGCTATGGCCATTTGGCAATATCTGAGACCCATTCTCATGACCTCGA
ACCAGGCATGACGACTGCATCTGTGAAGTCCAGAAAGGAAGATCATACCTATGATTTCAATGATGAACTGGAAGATGTTG
ACTTTGTTGGTGCCACTGGTGAGGAGAAGGATGATGAGACAACATTGGCTATCGAAGAGGAATTGGCGAAAGCTGATAAT
GAAGACCATGTCGAAGAGATTGCTCTGCTGCAAAAAGAGAATGAAATGCCTATTGAAGTACTACTTGCAAGGTATAAGGA
GGATTTCGGTGACAAGGATATATCTGAGGATGACTCTGAATATTCATGTGCTCAATCTGAAGACTCTATAGTAAACTCTG
ACGAAAATAGGCAGCAAGCTGATTCAGATAATGAAAACGTTGATTCAACAGAATGTAAGCCAGATCCAGAGCCTTGCTCA
GAAAATGTTGAAGGCACATTCCATGAAATAACAGAAGATAATGGTAAAGATAGTAGTGATAAAATTGCTGATGCAGCAGC
AGCAGCAAGATCTGCGCAGCCAACTGGATTTACATACTCCACAACAAAAGTTCGAACGAAACTGCCGTTTCTACTCAAGC
ATTCTCTGCGTGAGTACCAACACATTGGTTTGGACTGGCTTGTCACGATGTATGAGAAAAGGCTGAACGGTATTCTGGCT
GATGAAATGGGTCTTGGAAAGACCATTATGACCATTGCTCTTCTAGCACACCTCGCATGTGATAAGGGGATATGGGGTCC
CCATCTGATTGTGGTTCCAACAAGTGTGATGCTTAATTGGGAGACGGAGTTTCTTAAATGGTGTCCTGCATTTAAAATTC
TCACCTACTTTGGTAGTGCAAAGGAGCGGAAACTCAAGAGACAAGGATGGATGAAGCTTAACTCATTTCATGTATGCATA
ACGACCTATAGGCTAGTTATTCAGGACAGTAAAATGTTCAAGCGCAAGAAGTGGAAATACTTGATTCTTGACGAAGCCCA
TTTAATTAAGAATTGGAAGTCTCAGAGATGGCAGACACTATTGAACTTCAATTCTAAACGCAGAATTTTGTTGACTGGTA
CACCACTGCAGAATGATCTTATGGAATTGTGGTCACTTATGCATTTTCTGATGCCACATGTTTTTCAGTCCCACCAGGAA
TTCAAAGATTGGTTCTGTAACCCGATAGCAGGGATGGTTGAGGGACAAGAAAAAATCAACAAAGAAGTTATTGATCGCTT
ACATAATGTCCTCCGTCCTTTCCTTCTACGGCGCCTAAAAAGGGATGTGGAGAAGCAACTTCCTTCGAAACATGAGCATG
TTATTTTCTGTAGACTGTCTAAGAGGCAACGCAACTTGTATGAGGACTTCATAGCAAGCACAGAAACACAGGCTACGCTT
AACAGTGGAAGCTTTTTTGGGATGATAAGTATCATAATGCAGTTGCGGAAAGTTTGTAATCATCCTGATCTCTTTGAGGG
TCGTCCTATTGTAAGTTCTTTTGATATGGCTGGCATTGATGTGCAGTTGAGTTCAACAATCTGTTCGCTGCTTTTGGAAA
GTCCGTTCTCCAAGGTTGATCTTGAGGCTTTGGGATTCTTATTCACCCATCTTGATTTTTCGATGACTTCTTGGGAAGGA
GATGAGATAAAAGCTATTTCAACACCCTCAGAATTAATCAAACAGCGTGTGAACTTGAAGGATGATATGGAAGCAATCCC
TTTGAGTTTGAAAAACCGCAAAAATCTGCAAGGGACAAATATTTTTGAAGAAATTCGTAAGGCTGTTTTTGAGGAAAGGG
TTAAAGAAACTAAGGATCGGGCAGCAGCCATTGCCTGGTGGAATTCTTTGAGATGCCAGAGAAAGCCGACTTACTCTACA
TCTCTAAGAACTCTTTTGACCATTAAGGGTCCTCTTGATGATATACACCATCTTAAAGCTAACTGTTCATCTTACATGTA
TTCCTCAATCCTCGCTGACATAGTTCTTTCACCGATCGAGCGTTTTCAGCAAATGATTGAGCTAGTTGAAGCTTTCACTT
TTGTGATTCCAGCTGCACGAGTGCCTTCACCTGCTTGCTGGTGCAGCAAAAGTGACTCTCCTGTTTTTCTTAGTCCATCA
TACAAGGAGAAAGTTACAGATTTATTGTCACCTCTTTTATCTCCAATTAGACCTGCAATCGTTAGGAGACAAGTATATTT
CCCAGATAGGCGACTGATACAGTTTGATTGTGGTAAGCTGCAGGAGCTTGCAATGTTATTGAGGAAATTAAAATTTGGGG
GTCACAGAGCGTTGATATTCACGCAAATGACCAAGATGCTTGACGTCTTGGAGGCTTTCATTAATTTATATGGTTATACC
TACATGCGTCTTGACGGCTCTACTCCGCCAGAAGAGAGGCAGACATTAATGCAGCGGTTTAATACAAATCCCAAGATCTT
TCTTTTCATTTTGTCAACCCGAAGTGGGGGCGTTGGCATCAACCTTGTGGGTGCGGACACAGTTATATTCTATGACAGTG
ACTGGAATCCTGCTATGGATCAACAAGCTCAAGATCGCTGCCACAGGATAGGTCAAACACGTGAAGTGCATATTTACCGG
TTGATAAGTGAGAGCACCATTGAGGAGAATATCTTAAAGAAAGCAAACCAGAAGCGTGTGCTTGATAACCTAGTAATACA
AAACGGAGAGTATAACACCGAATTTTTCAAGAAGCTCGATCCAATGGAATTGTTCTCTGGGCATAAGACTCTGACTACAA
AGGATGAAAAGGAAACAAGCAAAAATTGCGGGGCGGAGATACCTCTGTCAAATGCAGATGTTGAGGCTGCTTTAAAACAG
GCAGAAGATGAGGCAGACTATATGGCTCTTAAAAGAGTAGAACAAGAAGAAGCTGTGGACAATCAAGAGTTTACAGAAGA
ACCTGTAGAGAGACCAGAAGACGATGAGCTAGTAAATGAAGATGACATAAAGGCTGATGAGCCTGCTGATCAAGGTTTAG
TTGCAGCCGGGTTGGCCAAAGAAGAAATTTCATTGTTACATAGTGATATTAGGGATGAGAGAGCTGTAATCACTACTTCA
AGCCAAGAAGATGACGCTGATGTGTTAGATGATGTCAAGCAAATGGCTGCAGCAGCCGCTGATGCTGGACAAGCTATCTC
ATCTTTTGAGAATCAGCTACGTCCTATTGATAGATATGCGATTAGATTTTTAGAGCTTTGGGACCCTATCATTGTTGAGG
CTGCAATGGAAAATGAAGCGGGATTTGAAGAGAAAGAATGGGAACTTGACCACATTGAGAAGTACAAGGAGGAAATGGAA
GCTGAGATTGATGATGGGGAAGAGCCTCTTGTTTACGAGAAATGGGATGCTGATTTTGCAACCGAGGCATACAGGCAGCA
AGTGGAAGTCTTAGCTCAGCACCAGTTGATGGAAGATTTGGAAAATGAAGCTAGAGAGAGGGAAGCTGCAGAGGTGGCTG
ATATGGATTTGACACAGAACGTAAGTGCTCATGTACTGAAGCCTAAGAAGAAGAAAAAGGCGAAGAAAGCCAAATATAAA
TCCCTGAAGAAAGGATCACTGGCTGCCGAAGCAAAACATGTGAAGTCAGTTGTGAAAATTGAAGATTCGACTGATGATGA
TAATGAAGAATTCGGCTATGTGAGTAGCAGTGACTCAGATATGGTTACACCACTTTCGCGGATGCATATGAAAGGCAAGA
AAAGAGATTTAATTGTTGACACTGAAGAAGAGAAAACCTCGCAGAAGAAAGCAAAGAAGCACAAGAAGTCTATTCTGAAT
TCAGATATCAAATATAAGCAAACAAGTGCTCTACTTGAGGAACTGGAACCATCAAAGCCGTCTGACAGTGTGGTTGTTGA
TAATGAATTGAAACTGACGAACAGGGGTAAAACTATAGGGAAAAAATTCATCACTTCCATGCCAATAAAGCGTGTTCTTA
TGATCAAGCCAGAGAAATTGAAGAAAGGAAATCTGTGGTCTAGAGATTGTGTTCCCTCGCCTGATTCTTGGTTGCCTCAG
GAAGATGCTATATTGTGTGCCATGGTTCATGAATATGGGCCTAATTGGAATTTGGTTAGCGGAACTCTTTATGGAATGAC
AGCTGGTGGGGCTTACAGAGGAAGGTATCGACATCCTGCATATTGTTGTGAGAGATATAGAGAGCTTATCCAACGACATA
TTTTGTCTGCTTCCGACAGTGCAGTGAACGAGAAGAACGTCAACACAGGTTCTGGGAAGGCTCTCCTTAAAGTCACTGAG
GAAAATATACGGACACTCCTAAATGTTGCAGCTGAGCAGCCAGATACGGAGATGCTCCTACAAAAACATTTTTCTTGCTT
GCTGTCATCAATTTGGAGGACGTCGACCCGAACTGGGAATGATCAAATGCTCTCCTTAAATAGTCCTATTTTCAACAGAC
AGTTTATGGGTTCCGTGAATCACACCCAAGATTTAGCTAGAAAGCCTTGGCAGGGGATGAAGGTCACCAGCTTAAGTAGA
AAGTTGTTAGAATCTGCTCTCCAGGATTCCGGCACGAGTCAGCCAGACGATACTGTTTCCCGTTCTAGGTTGCAGGAGAA
TCAACCTATCAATAAAGTGGGATTAGACTTAACCTTGGAATTCCCACGCGGCAAAGATGATTCCCTGACACAGTTTCCAC
CCATGATAAATCTGTCCATTGATGGGTCAGATTCATTAAATTATGTGAACGAGCCCACAGGGGAAGATGTTCTAAAAGGT
TCTAGGGTTGCTGCAGAGAACCGTTACAGGAATGCTGCAAATGCTTGTATTGAAGATTCATTTGGATGGGCTTCAAACAC
GTTCTCAGCCAATGATCTGAAGTCAAGAACAGGCACGAAAACACAGTCCCTGGGGAAACACAAGCTATCTGGCTCAGACT
CAGCCAAGTCAACAAAAAGCAAACACCGCAAACTCCTAGCAGAGCAATTGGAAGTGGCATGGGTTAGGCCAAATGACCCG
AATCTCAAGTTTGATTTCACACCTGCTGATAGGGAGGACGAGGAGCAGGAGGTGGAGGAGAACGCGGTTTCAGAAGAGAT
AGAGATGATAAGTTGTTCACAATGGTATGATCCATTCTTTACCTCAGGCCTTGATGATTGCTCACTAGCTTCGGATATCT
CAGAAATAGAGTAG