Details for Lyrate rockcress Locus 16061660

Position : sca3 ( 5`- 8716015 .. 8717722 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16061660

Protein [Map View]
MGSLSGILQRPLVAAAAVIAASVSADVSERFSSLRSLVRGSDSEQIAPSVPGSVQDERSLWVSQVSASKLSDLSFVSRIR
VPVPSVDLLASNPSCSLATSVTSLSALRCVYQSAELAKASKPSAFTIRASLVVPDISYRWHLPEPNAIDLSGSSSCVSEK
NRTVVVLLGWLGSKQKHLKKYADWYTSRGYHVITFTLPMNEIMSYQVGGKAEKNIESLVNHLADWLDEEQKKNLVFHTFS
NTGWLTYGAILEKFQKQDSSLMGRVKGCIVDSAPVADADPTVWASGFSAAFLKKNSVATKGSASSSNESNGINFSQPKPG
ATETALLLVLEKFFAVILNLPKVNRRLADVLDTLSSAQPRCPQLYIYSSADRVIPAEQVESFIVEQRKAGHEVRACNFIS
SPHVDHFRSNPELYTAELNHFMDNFVLSCCNRSS*

DNA
ATGGGTTCTTTGTCTGGGATCCTTCAGCGGCCACTTGTTGCTGCTGCTGCTGTTATTGCCGCTTCTGTGTCTGCAGATGT
CTCTGAGAGGTTCTCATCTCTCAGATCACTAGTTCGAGGTTCTGATTCGGAGCAGATTGCTCCTTCGGTGCCCGGTTCAG
TTCAGGACGAAAGGTCCTTGTGGGTTTCTCAGGTCTCGGCCTCCAAGCTCTCGGATTTATCTTTTGTGTCGAGGATTCGT
GTTCCTGTACCAAGTGTTGATCTCTTAGCTTCTAATCCGAGCTGTAGTCTCGCTACTTCTGTTACTTCTCTGTCCGCTCT
TCGTTGTGTTTATCAGTCTGCTGAATTGGCTAAAGCATCAAAACCATCGGCATTCACAATCAGGGCCTCGCTTGTGGTTC
CTGATATTTCCTACAGATGGCATTTACCTGAGCCCAATGCAATCGATTTGTCTGGTTCCTCGAGTTGTGTGTCTGAGAAG
AATAGAACTGTTGTGGTTTTGCTTGGATGGCTTGGATCAAAGCAGAAGCATCTGAAGAAATATGCTGATTGGTACACTTC
TAGGGGTTATCATGTCATTACATTTACTCTTCCCATGAATGAAATTATGAGTTATCAAGTTGGAGGAAAAGCAGAGAAGA
ACATCGAGTCATTGGTTAATCACTTGGCTGATTGGTTGGATGAAGAGCAAAAGAAAAATCTGGTCTTTCACACCTTCAGC
AACACCGGGTGGTTAACATATGGAGCTATTTTGGAAAAGTTTCAGAAGCAAGATTCATCATTGATGGGAAGGGTTAAAGG
TTGCATAGTGGACTCAGCTCCTGTTGCTGATGCAGATCCTACGGTATGGGCATCAGGTTTCTCAGCAGCGTTCTTGAAGA
AAAACAGCGTAGCCACTAAAGGATCTGCGAGCTCGTCAAATGAGTCAAACGGTATAAACTTCTCCCAGCCTAAACCCGGT
GCAACAGAAACAGCTCTGCTTTTGGTTCTTGAAAAGTTCTTCGCGGTGATTCTAAATCTTCCGAAAGTAAACAGGAGACT
TGCCGATGTTCTAGACACTTTATCATCAGCACAACCAAGATGTCCACAGCTATACATATACAGCTCTGCAGATAGAGTTA
TACCCGCAGAACAAGTTGAATCATTCATTGTAGAACAGAGGAAAGCTGGACACGAGGTCCGTGCTTGCAACTTCATATCT
TCACCTCATGTAGACCATTTCCGGAGTAACCCAGAACTGTATACAGCTGAGCTCAACCATTTCATGGACAACTTTGTCCT
TTCTTGCTGCAACCGTTCTTCATAG