Details for Lyrate rockcress Locus 16061647

Position : sca3 ( 5`- 5311268 .. 5312308 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16061647

Protein [Map View]
MATFHTVKDAVKLFDAGISGGKHINKRQGQGVLVEETNLCLWSKEVNKLKEKIKNAEKTKIEALLELEEAKNTVEHLSQK
LGIKQTMTNDEKDLDLSSSVRVVTSELCVAKESIHRVAEEESELCMLMESLKLELQNVEKEHSELKEIEQRERDLEAIED
LDKETKAAKAELSLLEEELKIVLFEAREAKDAEEHARERLNVAVLESDFRSSVEVKESGAEELTETEALRACRDETLKTL
EMSEREIEDIKAATQDALKKAEMAQEATIAVDVELKRRRKAASRILAESKMCAKSTKEVIKSKPRSASKEGCLVKC*

DNA
ATGGCTACTTTTCATACCGTTAAAGATGCGGTGAAGCTCTTTGACGCAGGTATTTCTGGAGGAAAACACATCAACAAGAG
ACAAGGACAGGGAGTGTTGGTGGAGGAGACAAATCTCTGTCTCTGGTCTAAAGAGGTTAACAAGTTGAAAGAAAAGATAA
AGAATGCTGAGAAGACCAAGATTGAGGCTTTGTTAGAGCTTGAGGAAGCTAAGAACACGGTTGAGCATCTCAGTCAGAAG
CTGGGAATTAAGCAGACCATGACAAATGATGAGAAAGATTTAGATTTGAGTAGTAGTGTAAGAGTTGTGACTTCTGAGCT
ATGTGTTGCAAAGGAATCGATTCATAGAGTAGCTGAAGAGGAGAGTGAATTGTGTATGTTAATGGAATCTCTGAAGCTCG
AGCTTCAAAACGTGGAGAAAGAACATTCAGAGCTCAAAGAGATTGAGCAAAGAGAGAGGGATCTAGAAGCCATTGAGGAT
CTGGATAAGGAAACCAAAGCTGCAAAGGCAGAGCTCTCGCTGTTAGAAGAAGAGCTCAAGATTGTTCTTTTCGAGGCTCG
AGAAGCAAAAGATGCAGAGGAACACGCCAGGGAACGGCTAAATGTTGCAGTTTTAGAATCTGATTTCAGATCATCAGTTG
AGGTGAAAGAAAGTGGTGCTGAAGAATTAACTGAGACAGAAGCTTTAAGAGCTTGCAGAGACGAAACACTCAAGACACTA
GAAATGAGTGAGAGAGAGATTGAAGATATAAAAGCTGCAACACAAGATGCGTTGAAGAAAGCTGAGATGGCTCAAGAAGC
TACAATTGCGGTGGATGTAGAGCTTAAACGACGGCGTAAAGCAGCGAGTAGGATTTTGGCAGAATCCAAAATGTGTGCCA
AATCAACAAAGGAAGTCATCAAGTCAAAACCAAGATCAGCTTCAAAAGAAGGTTGTTTGGTCAAGTGTTAG