Details for Lyrate rockcress Locus 16061603

Position : sca3 ( 5`- 7402841 .. 7404093 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_341872 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16061603

Protein [Map View]
MKKLFFFFSFLYTITTLTFPPLTTSAATSCRTLCGNIPINYPFGIDGGCGSPQFKGMFNCSTDLFFTTPSGSYKVQSIDY
EKKTMVIFDPAMSTCSILQPHHDFKMADIQNALIRPSYDTVFALFNCSNDSPVHNRYRNLCFNAAGHSCDELYSSCTSFR
IFNTTSPSGNSTIHTTPYCCFTSYDTVRVMSMNILDCSHYTTVIDNGKMRGVAPLDWSYGIELSFSVPEIGCDRCRKSGG
TCGFDAETEIFLCQCSGSNNNPTRECGGGMTNQGGCNSININYTTILLVMFMSFLYTVL*

DNA
ATGAAGAAGCTCTTCTTCTTCTTCTCCTTCCTCTACACAATCACAACCCTAACATTTCCGCCATTAACAACGTCAGCAGC
AACATCATGCCGAACATTATGCGGCAACATCCCAATAAACTACCCATTCGGCATCGACGGCGGTTGCGGATCTCCTCAGT
TCAAAGGAATGTTCAATTGCTCCACCGATCTATTTTTCACCACTCCTTCCGGCAGCTACAAGGTCCAGAGCATCGATTAC
GAGAAGAAAACTATGGTAATCTTCGATCCGGCGATGTCTACTTGCTCGATTCTTCAGCCTCACCACGATTTCAAAATGGC
GGATATTCAAAACGCTCTTATTAGACCTTCGTACGACACCGTTTTCGCACTTTTTAACTGTTCCAACGACTCTCCTGTGC
ATAATCGTTACCGGAATCTCTGTTTTAATGCCGCCGGTCACTCTTGCGACGAGCTTTATAGCTCTTGTACTTCCTTTCGC
ATCTTCAACACTACCTCTCCCTCTGGTAATAGTACGATTCATACGACGCCGTATTGCTGTTTCACTAGCTACGATACGGT
GCGGGTGATGAGTATGAACATTTTGGATTGCTCGCATTACACGACGGTGATTGACAATGGGAAAATGAGAGGCGTGGCAC
CTTTGGATTGGTCGTATGGAATTGAGCTTTCGTTCTCGGTGCCGGAGATTGGCTGTGACCGTTGCCGGAAGTCAGGTGGT
ACCTGTGGTTTTGACGCCGAGACGGAGATATTTCTTTGCCAATGTTCTGGTTCCAACAACAACCCTACGAGAGAATGTGG
TGGAGGTATGACTAATCAAGGAGGCTGCAATTCTATAAACATAAATTATACAACCATTCTCTTGGTTATGTTCATGTCTT
TTCTTTACACTGTTTTGTGA