Details for Lyrate rockcress Locus 16061597

Position : sca3 ( 5`- 2127090 .. 2128594 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16061597

Protein [Map View]
MSLTQIVNPIIYPSRTIPRRFTAISPFQTLNPQFSRHPPHALSRRLFLPSVSSIWDAITGGGDSNPREAIAAVRRGMQLF
RQGDVAGSVAEFDRAIVLDPRQKAYLWQRGLSLYYVDRFEEGAEQFRIDVAQNPNDTEESIWCFICEARLHGVDVARKQF
LEVGRDSRPVMREAYNLFKNGGDPEKLVNDFLSGQASEYFYASLYAGLYYEAEGKSENAKFHITAASGSPYGQRSDDYMA
SLAKVHCLSRNWSSGIV*

DNA
ATGTCACTAACCCAGATCGTGAATCCTATCATATATCCATCTCGCACAATTCCACGGCGTTTCACGGCGATTTCACCTTT
TCAAACCCTAAACCCCCAATTTTCCCGCCACCCACCTCACGCACTGTCTCGGAGACTCTTCCTTCCTTCTGTTTCCTCGA
TATGGGATGCCATAACCGGTGGTGGAGACTCGAACCCCCGTGAGGCCATTGCAGCGGTTCGACGCGGAATGCAGCTCTTC
AGACAGGGTGATGTTGCTGGATCGGTGGCAGAGTTCGATAGAGCAATCGTTTTGGATCCCAGGCAAAAGGCATATCTTTG
GCAACGCGGGCTTTCTCTTTACTATGTAGATAGGTTTGAAGAAGGTGCAGAGCAGTTCCGGATAGATGTTGCTCAGAACC
CAAATGATACAGAGGAGTCCATTTGGTGCTTTATCTGCGAGGCTCGGCTCCACGGTGTTGATGTTGCACGAAAACAGTTT
CTCGAGGTTGGTAGAGATTCTCGGCCTGTGATGCGGGAAGCTTATAACCTATTCAAGAATGGTGGTGATCCTGAAAAGTT
AGTTAATGACTTCTTGAGCGGTCAAGCAAGCGAATACTTCTACGCTTCGCTGTACGCAGGGCTCTACTATGAAGCTGAGG
GTAAATCAGAAAACGCAAAGTTTCATATAACCGCGGCTAGTGGATCTCCATATGGGCAGAGGTCTGACGATTATATGGCT
TCACTTGCTAAAGTTCACTGCCTTAGTAGAAACTGGAGCTCAGGTATTGTTTGA