Details for Lyrate rockcress Locus 16061585

Position : sca3 ( 5`- 3389328 .. 3390370 -3` )
Annotation : [B2G] vacuolar h+-atpase subunit e isoform 2
External links : CoGe
PGDD synteny : 16061585

Protein [Map View]
MNDADVSKQIQQMVRFIRQEAEEKANEISISAEEEFNIERLQLLESAKRKLRQDYDRKLKQVDIRKRIDYSTQLNASRIK
YLQAQDDVVTAMKASAAKDLLRVSNDKNNYKKLLKSLIIESLLRLKEPSVLLRCREMDKKVVESVIEDAKRLYAEKAKVG
SPKITIDDKVFLPPPPNPKLPDSHDPHCSGGVVLASQDGKIVCENTLDARLDVAFRQKLPQIRTRLVGAPETSRA*

DNA
ATGAACGATGCAGATGTGTCAAAGCAGATACAGCAGATGGTCCGGTTCATCCGGCAAGAAGCAGAAGAGAAAGCAAATGA
GATCTCCATCTCCGCCGAGGAGGAATTCAACATCGAAAGACTTCAGCTTCTCGAGTCTGCCAAGCGTAAGCTCCGTCAAG
ACTACGACCGCAAGCTCAAGCAGGTCGATATCCGCAAGCGAATCGACTACTCCACGCAACTTAATGCAAGTAGGATTAAG
TACCTTCAAGCACAAGACGACGTTGTCACCGCCATGAAAGCGTCAGCAGCTAAGGATCTTCTTCGTGTCTCCAACGACAA
GAACAATTACAAGAAGCTTCTTAAGAGTCTCATCATTGAGAGTTTGCTGCGCCTGAAAGAGCCATCAGTGCTGCTGCGAT
GCAGAGAGATGGACAAGAAGGTTGTTGAATCAGTCATCGAGGATGCTAAAAGACTGTACGCGGAAAAAGCCAAAGTCGGG
TCTCCTAAGATCACCATCGACGACAAGGTCTTCCTCCCTCCACCTCCTAATCCTAAGCTCCCTGATTCCCACGATCCTCA
CTGCTCGGGCGGGGTGGTGCTGGCCTCTCAAGACGGCAAGATTGTCTGTGAGAACACTTTAGATGCACGCCTTGACGTCG
CCTTCAGACAGAAGCTTCCCCAGATCCGGACGCGCCTCGTTGGAGCTCCTGAAACCTCCAGAGCATGA