Details for Lyrate rockcress Locus 16061570

Position : sca3 ( 5`- 7351451 .. 7349495 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_898058 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16061570

Protein [Map View]
MAMASLARRKAYFLTRNISNSPTDALRFSLSLTRGFASSGSDDNDVVIIGGGPGGYVAAIKAAQLGLKTTCIEKRGALGG
TCLNVGCIPSKALLHSSHMYHEAKHVFANHGVKVSSVEVDLPAMLAQKDTAVKNLTRGVEGLFKKNKVNYVKGYGKFLSP
SEVSVDTIDGENLVVKGKHIIVATGSDVKSLPGITIDEKKIVSSTGALSLTEIPKKFIVIGAGYIGLEMGSVWGRLGSEV
TVVEFAADIVPAMDGEIRKQFQRSLEKQKMKFMLKTKVVGVDSSGDGVKLIVEPAEGGEQTTLEADVVLVSAGRTPFTSG
LDLEKIGVETDKGGRILVNERFSTNVSGVYAIGDVIPGPMLAHKAEEDGVACVEFIAGKHGHVDYDKVPGVVYTYPEVAS
VGKTEEQLKKDGVSYNVGKFPFMANSRAKAIDTVEGLVKILADKETDKILGVHIMSPNAGELIHEAVLAINYDASSEDIA
RVCHAHPTMSEAIKEAAMATYDKPIHM*

DNA
ATGGCTATGGCGAGCTTAGCTAGGAGAAAAGCGTACTTTCTCACCAGAAACATCTCTAATTCTCCCACTGACGCTCTCAG
ATTCTCTCTCTCCCTCACTCGCGGCTTCGCTTCGTCGGGATCCGACGACAACGACGTTGTCATCATCGGCGGCGGTCCTG
GAGGCTATGTGGCGGCGATTAAAGCGGCGCAGCTCGGTCTCAAGACAACTTGCATCGAAAAGCGCGGCGCTCTCGGTGGT
ACTTGCCTTAATGTCGGCTGTATTCCTTCAAAGGCCCTTCTTCACTCTTCTCACATGTACCATGAAGCAAAACACGTTTT
TGCTAACCACGGTGTTAAGGTTTCTTCAGTTGAGGTAGATCTTCCTGCTATGTTGGCTCAGAAAGACACAGCCGTCAAGA
ATCTCACCCGTGGTGTCGAAGGTCTTTTCAAGAAGAACAAGGTAAACTATGTTAAGGGCTACGGTAAGTTTCTGTCCCCA
TCAGAAGTCTCTGTGGACACAATCGATGGAGAAAACTTGGTTGTGAAAGGCAAACATATCATAGTTGCAACTGGCTCGGA
TGTCAAGTCTTTGCCAGGCATCACCATCGATGAAAAGAAGATTGTCTCATCAACTGGGGCACTGTCTCTGACAGAAATCC
CAAAGAAATTCATAGTCATTGGTGCTGGCTATATTGGGCTCGAGATGGGTTCTGTATGGGGACGGCTCGGATCAGAGGTT
ACAGTTGTTGAGTTTGCAGCGGATATCGTACCAGCAATGGATGGTGAAATCCGCAAGCAGTTTCAACGTTCACTAGAGAA
GCAAAAGATGAAATTCATGCTGAAGACTAAAGTCGTCGGCGTAGATTCATCTGGAGATGGTGTGAAACTAATAGTGGAAC
CTGCTGAAGGTGGAGAGCAGACCACTCTAGAAGCTGATGTGGTCCTCGTCTCAGCTGGTAGAACTCCGTTCACATCTGGA
CTTGATCTAGAGAAAATCGGAGTTGAGACAGACAAAGGCGGGAGAATTCTGGTGAACGAGAGATTCTCGACAAATGTTTC
AGGCGTTTATGCAATTGGAGATGTGATTCCAGGACCAATGCTGGCTCACAAAGCCGAAGAAGATGGTGTCGCATGTGTCG
AGTTTATAGCAGGCAAACACGGTCATGTGGATTACGACAAAGTCCCTGGGGTTGTCTACACGTACCCTGAAGTTGCCTCA
GTTGGTAAAACTGAGGAGCAGCTGAAGAAAGACGGTGTAAGCTACAATGTCGGAAAATTCCCATTCATGGCCAATAGCAG
AGCCAAGGCCATAGACACAGTAGAGGGGCTGGTCAAGATTTTGGCTGATAAAGAGACAGACAAGATCTTGGGAGTTCACA
TTATGTCACCAAACGCAGGAGAATTGATCCATGAGGCGGTTCTAGCTATCAACTATGATGCATCAAGCGAAGACATTGCT
CGAGTCTGTCATGCTCATCCCACCATGAGTGAGGCTATCAAGGAAGCTGCCATGGCTACCTATGACAAGCCCATTCACAT
GTAG