Details for Lyrate rockcress Locus 16061569

Position : sca3 ( 5`- 9886343 .. 9885840 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16061569

Protein [Map View]
MNQSEHNDFSGTVQRSSQTSSESSYTSPPPPIGYPTRDAVVGDPPAVATETKSKNLEETAKICGCLGACCNCLTACCNFL
TCVSG*

DNA
ATGAATCAATCCGAGCACAATGACTTTTCCGGCACAGTGCAAAGATCTTCACAGACTTCATCAGAGTCGTCGTACACAAG
TCCTCCGCCGCCGATTGGTTATCCGACTAGAGATGCGGTGGTGGGTGATCCTCCGGCAGTAGCAACGGAGACTAAGTCCA
AGAACCTCGAAGAAACAGCCAAGATATGCGGTTGTTTGGGGGCATGTTGCAATTGTTTGACGGCATGTTGCAATTTTCTT
ACGTGCGTATCAGGATGA