Details for Lyrate rockcress Locus 16061560

Position : sca2 ( 5`- 16468060 .. 16469270 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_476623 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16061560

Protein [Map View]
MVADSITDSELFHGSPISRDFAKKRKANWFCKLKQWKIDARRKQWIYQWKKANLGEEDNGRRLKSLLEKLTDQKAWRIDY
DDADDDLERTSSSASSPTSVLKSKDSVTGDCFCCSKQMTEEDQEEVFDDAYDNWDGFRDALNSFDNQSPRLETEDLEQEE
DPIPDTSQRRKKSTHEKLFHEDKKEASPANTTIHRNSKKKKRSNSEKQRGDDDEECPICSELMDATDLEFEPCPCGFRIC
LFCHKKISENEARCPACRKDYVRTSNSNGEVGFQQRGGATIRLSPSFRGLDRA*

DNA
ATGGTTGCTGATTCAATCACAGACTCTGAGCTCTTTCATGGCTCTCCGATTTCAAGAGATTTCGCCAAGAAACGCAAGGC
GAATTGGTTTTGTAAACTAAAGCAGTGGAAGATTGATGCTCGTCGCAAGCAATGGATTTATCAATGGAAAAAAGCAAATC
TTGGTGAAGAGGATAATGGGCGTAGACTGAAATCTTTGCTAGAGAAACTGACTGATCAAAAAGCTTGGAGGATTGATTAT
GATGATGCGGATGATGATCTTGAAAGGACATCATCATCTGCTAGTAGCCCCACGAGTGTTCTCAAGAGCAAAGATTCTGT
TACTGGCGATTGCTTCTGTTGTTCTAAGCAGATGACTGAGGAAGATCAGGAAGAAGTTTTTGACGATGCTTATGATAACT
GGGATGGGTTTAGAGATGCGTTAAACTCCTTTGACAACCAAAGCCCTCGACTTGAGACTGAAGATTTAGAGCAAGAAGAA
GATCCGATTCCAGATACAAGCCAGAGGAGGAAGAAGTCTACCCATGAGAAGCTTTTTCATGAAGACAAGAAAGAAGCTTC
ACCTGCAAACACGACGATTCACAGAAACAGTAAAAAGAAGAAGAGGTCTAACTCTGAGAAGCAACGAGGTGATGATGATG
AAGAATGTCCTATTTGCTCTGAGTTGATGGATGCAACGGATCTAGAATTCGAACCATGTCCTTGTGGGTTTCGGATTTGT
CTCTTTTGCCATAAGAAGATCAGTGAAAACGAAGCACGTTGTCCAGCTTGCAGGAAGGATTATGTTCGGACGAGTAATAG
TAATGGAGAGGTAGGTTTCCAGCAACGTGGTGGTGCCACAATTCGCTTGTCTCCGTCTTTTAGAGGACTTGACAGAGCTT
AA