Details for Lyrate rockcress Locus 16061557

Position : sca3 ( 5`- 3584292 .. 3582223 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16061557

Protein [Map View]
MVVFPKSLSPKHVLKLLKSEKNPRAAFALFDSATRHPGYAHSAVVYHHILRRLSEARMVTHVGRIVELIRSQECKCDEDV
ALSVIKTYGKNSMPDRALDVFKRMREIFGCEPGIRSYNTLLNAFVEAKQWVKVESLFAYFETAGVAPNLQTYNVLIKMSC
KKKEFEKARGFLNWMWKEGFKPDVFSYSTVINDLAKTGKLDDALELFDEMSERRVAPDVTCYNILIDGFLKEKDHKMAMQ
LWDKLLEDSSVYPNVKTHNIMISGLSKCGRVDDCLKIWDRMKQNEREKDLYTYSSLIHGLCDEGNVDKAESVFNELVERK
AFIDVVTYNTMLGGFCRCGKIKESLELWRIMEQRNSVNIVSYNILIKGLLENGKIDEATMIWRLMPAKGYAADNTTYGIF
IHGLCVNGYVNKALGVMQEVESKGGHLDVYAYASIIDCLCKKRRLEEASNLVKEMSKHGVELNSHVCNALIGGLIRDSRL
SDASLLMRGMGKNGCLPTVVSYNILICGLCEAGKFGEASAFVKEMLENGLKPDLKTYSILLGGLCRDRKIELALELWHQF
LQSGLEPDVMMHNILIHGLCSVGKLDDAMTVMANMEHRNCTANLVTYNTLMEGYFKVRDSNRATVIWGYMYKMGLQPDII
SYNTILKGLCLCHRVSYAIEFFDDARNHGIFPTVYTWNILVRAVVNRKM*

DNA
ATGGTCGTGTTCCCAAAGTCGCTGTCACCCAAACACGTCCTTAAGCTCTTGAAATCGGAGAAGAACCCGCGTGCGGCTTT
TGCTCTATTCGATTCAGCGACTCGCCATCCAGGCTATGCACACTCCGCCGTCGTCTACCACCACATCCTCCGACGTCTCT
CGGAAGCGCGGATGGTTACACACGTGGGTCGAATCGTCGAGCTCATTAGGTCACAAGAATGCAAGTGCGACGAAGATGTG
GCTTTATCGGTTATCAAAACCTACGGAAAGAACTCCATGCCCGATCGAGCTCTAGATGTTTTCAAACGAATGCGAGAGAT
TTTCGGGTGCGAGCCTGGGATTCGATCTTATAATACTCTACTCAATGCGTTCGTAGAGGCGAAACAATGGGTTAAAGTCG
AGTCCTTGTTCGCCTACTTCGAAACAGCGGGTGTGGCGCCAAATCTGCAGACGTATAATGTTTTGATTAAGATGTCTTGT
AAGAAGAAGGAGTTCGAGAAAGCGAGAGGGTTTCTTAATTGGATGTGGAAAGAGGGTTTTAAGCCGGATGTGTTTAGTTA
CAGCACTGTGATCAACGATCTTGCGAAAACTGGAAAATTGGATGATGCATTGGAACTGTTCGATGAAATGTCTGAAAGAA
GAGTGGCACCTGATGTTACGTGTTATAATATCTTAATTGATGGGTTTCTTAAGGAAAAAGATCACAAGATGGCTATGCAA
CTGTGGGACAAACTGTTGGAGGACTCTTCTGTTTATCCGAATGTTAAGACTCACAACATCATGATTAGTGGTTTGAGCAA
ATGTGGAAGAGTAGATGATTGTTTGAAGATATGGGACAGAATGAAACAGAATGAGCGAGAAAAAGATTTGTATACATATA
GCAGTTTGATACATGGGCTGTGCGATGAAGGGAATGTTGATAAGGCTGAAAGTGTGTTTAACGAGTTGGTCGAAAGGAAG
GCCTTTATTGATGTGGTTACATACAATACTATGCTTGGTGGGTTTTGCCGTTGTGGGAAAATTAAGGAGAGTTTGGAGTT
ATGGAGAATCATGGAGCAGAGGAATTCAGTTAACATAGTGAGTTATAACATTTTGATAAAAGGGTTGTTGGAGAATGGGA
AGATCGATGAAGCAACAATGATTTGGAGGCTTATGCCTGCCAAGGGCTATGCAGCTGACAACACAACTTATGGTATTTTT
ATTCACGGGTTATGTGTGAATGGTTATGTAAATAAAGCCTTGGGGGTGATGCAAGAGGTGGAGAGCAAAGGTGGGCATCT
GGATGTTTATGCATATGCGTCAATTATAGACTGTTTGTGCAAAAAGAGAAGATTAGAAGAAGCGTCAAATTTGGTAAAAG
AGATGAGTAAGCATGGCGTGGAGCTGAATTCTCATGTCTGCAATGCATTAATAGGTGGTTTAATCCGAGACTCAAGACTT
AGTGATGCTTCCCTTTTGATGAGAGGGATGGGGAAGAACGGTTGTCTCCCGACTGTTGTATCCTACAACATTCTTATTTG
CGGTTTGTGTGAAGCAGGGAAATTTGGTGAAGCATCTGCTTTTGTGAAAGAAATGCTTGAAAACGGACTGAAACCAGATC
TGAAAACATATAGTATACTCTTGGGTGGTCTTTGCCGCGACAGGAAGATCGAATTGGCCCTTGAATTGTGGCACCAATTT
CTTCAATCGGGTCTAGAACCCGATGTGATGATGCATAACATACTAATTCATGGTCTGTGCTCTGTTGGGAAACTTGATGA
TGCAATGACTGTCATGGCAAATATGGAGCATCGGAATTGCACTGCAAATCTTGTAACCTACAACACCTTGATGGAAGGAT
ACTTCAAAGTTAGAGACAGCAACAGAGCCACAGTGATTTGGGGTTACATGTACAAGATGGGGTTGCAACCTGATATTATA
TCCTACAATACTATACTGAAAGGGTTGTGTCTGTGCCACAGAGTGTCGTATGCAATTGAATTCTTTGATGATGCTAGAAA
CCATGGCATTTTCCCAACTGTTTACACGTGGAACATACTTGTTCGAGCTGTCGTGAATCGCAAAATGTGA