Details for Lyrate rockcress Locus 16061519

Position : sca2 ( 5`- 16550501 .. 16547826 -3` )
Annotation : [B2G] j-domain protein required for chloroplast accumulation response 1
External links : CoGe
PGDD synteny : 16061519

Protein [Map View]
MQTLPSSETVLLGSNSAPPVLRNPGGDDVDIDFGDVFGGPPKRRSKVTNSNQVTRHSFSESALRRRDVIVDVGSLIPQDE
KPVFGEETSVRRRFTTDDFFDDIFRVNESSSSSLPGSRILSPAHKPESSGTSSPAQFSLPAKATEIPTFGLATRSLSKNK
ETVSSSPLSRTSSKADMVSTAKSYSDDCDDPARVVVTGKGRQFHFSIYKWPNKGVPVVIWGSSRLSSMSKAEGTTPVTLG
DHLKTSVEKAGENEEGESGLKEEKKTSLNRPHVQTKEEKTEIDSVSEKAFFGVSKAREANVKPLYSIDSMSEQAFSGVSK
AHEATTVKSLHSILHENDERQGEKIVSEREVRKGKSKAKNTQSFTEDSRTKKKPQGTKNSLDSSPRPDKSSFASSSAAAE
VGKDGVKGKVSDFVKIFSKGASVGAGGESLGQSSRWRAKETPKTDINHDAANAKDTVNIPDQQKKSTPDIPAMNRDSKPS
HATQKKDSDRESMNYKAPGVTVQEERQEPSTTHTTSEDIDEPFHVNFDVEDITQDENNKMEETNKDAEEIKKIDAKIRKW
SSGKSGNIRSLLSTLQYILWSGSGWKPVPLMDMIEGNAVRKSYQRALLILHPDKLQQKGASANQKYMAEKVFEFLQEAWD
HFNTLGPV*

DNA
ATGCAGACATTACCAAGCTCAGAAACCGTTCTTTTGGGCTCCAACTCTGCACCACCTGTGCTACGTAATCCCGGCGGTGA
TGACGTGGACATCGATTTCGGTGACGTGTTTGGTGGTCCTCCTAAGAGACGCTCTAAAGTTACTAATAGTAACCAAGTCA
CGCGACATAGCTTCAGTGAATCCGCTCTCAGGCGTCGTGACGTCATCGTCGACGTCGGCTCTCTGATTCCTCAAGACGAG
AAGCCTGTTTTCGGCGAAGAGACATCCGTCCGGCGTCGTTTCACTACTGATGATTTCTTCGACGATATTTTCAGAGTTAA
TGAATCATCTTCATCATCACTTCCGGGTTCTCGGATCCTAAGCCCGGCTCACAAACCAGAATCTTCAGGGACTTCGTCTC
CTGCACAATTCAGTCTTCCTGCAAAAGCAACAGAGATTCCTACATTTGGTTTAGCTACTCGTAGTTTGAGCAAGAACAAA
GAAACTGTTTCGAGCTCTCCTTTGTCAAGAACTTCAAGCAAAGCCGATATGGTCTCTACTGCTAAATCATATTCAGATGA
TTGTGATGATCCTGCACGAGTTGTTGTTACTGGCAAAGGCAGGCAGTTTCATTTCTCTATTTACAAGTGGCCTAATAAAG
GTGTTCCTGTTGTTATTTGGGGAAGCTCTAGACTAAGTTCTATGTCTAAAGCTGAGGGGACAACGCCGGTGACATTGGGT
GATCATCTAAAAACTTCAGTTGAGAAAGCGGGTGAAAATGAAGAAGGAGAAAGTGGTTTGAAAGAGGAGAAGAAGACCTC
GCTAAATCGTCCTCATGTTCAGACAAAAGAAGAGAAAACAGAAATCGATTCGGTGTCTGAAAAAGCCTTCTTTGGTGTGT
CAAAAGCACGTGAGGCTAATGTGAAGCCTCTTTATTCAATTGATTCGATGTCTGAACAGGCCTTCTCTGGTGTGTCAAAA
GCTCATGAAGCTACTACTGTGAAGTCTCTTCATTCAATTTTGCATGAAAACGATGAAAGACAAGGTGAGAAAATAGTATC
AGAGAGAGAAGTGAGAAAAGGTAAAAGCAAAGCGAAGAACACGCAAAGTTTTACTGAAGATTCAAGAACAAAAAAGAAAC
CACAAGGCACTAAAAATTCTTTGGATAGTAGCCCGAGACCCGATAAATCCAGCTTCGCAAGTTCATCCGCAGCAGCAGAA
GTTGGCAAAGATGGAGTCAAAGGAAAAGTGAGTGACTTTGTTAAGATTTTCAGTAAAGGAGCTTCAGTTGGAGCAGGTGG
GGAATCTCTTGGACAAAGCTCTAGATGGAGAGCTAAAGAAACTCCCAAGACTGATATCAATCATGATGCTGCTAATGCCA
AAGATACTGTAAACATTCCTGATCAACAAAAGAAATCGACTCCAGATATCCCCGCTATGAATCGGGATTCGAAACCTTCA
CACGCAACTCAGAAAAAGGATTCAGACCGGGAGAGCATGAACTATAAGGCTCCTGGTGTTACTGTACAAGAAGAGAGACA
AGAACCGAGCACAACACATACTACCTCAGAGGATATAGATGAGCCCTTCCATGTAAATTTCGATGTGGAGGATATAACAC
AAGATGAAAACAACAAAATGGAAGAAACCAATAAGGATGCTGAAGAAATCAAGAAGATCGATGCTAAAATCCGCAAGTGG
TCAAGTGGAAAGAGCGGAAACATTCGGTCTCTTCTATCCACGCTGCAATATATTCTTTGGTCCGGGAGCGGGTGGAAGCC
AGTTCCTCTAATGGATATGATCGAAGGAAACGCGGTCCGAAAATCGTACCAGAGGGCATTACTAATCCTTCATCCAGACA
AACTACAGCAAAAGGGTGCTTCTGCAAACCAGAAATACATGGCCGAGAAAGTTTTCGAATTTTTACAGGAAGCATGGGAC
CACTTCAACACTCTCGGACCGGTTTAA