Details for Lyrate rockcress Locus 16061516

Position : sca3 ( 5`- 8431230 .. 8428375 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479466 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16061516

Protein [Map View]
MHRAASKRVTRSSGSGLKQTNVEINPTVDKVSEQGQNSEAGSHMPNDANENGHLHHDIMENGKGNEQLKPTPQTGKKRSS
TNTKISGSHRELVIGLPCRGQFEIHRSRSSTSSKRLGGGGERNVLFSSHKGAQRSKEDAGSSSVAANSTPVGRPKKRNKT
MKKGEVREDDEYTRIKKKLRYFLNRISYEQNLIDAYSLEGWKGSSLEKIRPEKELERATKEILRRKLKIRDLFQHLDTLC
AEGSLPESLFDSDGEISSEDIFCAKCGSKDLSVDNDIILCDGFCDRGFHQYCLEPPLRKEDIPPDDESWLCPGCDCKDDS
LDLLNDSLGTKLLVSDSWEKIFPEAAAALAGGGQNLDCDLPSDDSDDEEYDPDGLNDNENDEDGSDDNEESENEDDSSDE
SESTSASDKMIESFKEGKDIMKDIMALPSDDSEDDDYDPDAPTCDEDKESSNSDCTSDYEDLETSFKGDESNQQAEDTPF
EDPGRQTSQLPCDAILESDVGLDDGPAGVSRRRNVERLDYKKLYNEEYDNVPTSSSDDDDWDKTARMGKEDSESEDEGDI
VPLKQSSNAEDHTSKKPRRKSKRTDKKDTLEVPQECPGENGGSGEIEKSSSSANKQTDPKTQRLYISFQENRYPDKATKE
SLAKELQMTVTQVNNWFKNRRSSINSKPLVSEENVEKLKTGKEGECETSVAGSSVQTMETESVAENKSRASESTNTGSRK
RRRK*

DNA
ATGCATAGAGCAGCCAGTAAACGGGTAACTAGGAGTAGTGGATCTGGTTTGAAGCAGACAAACGTAGAGATTAATCCAAC
TGTTGACAAAGTATCTGAACAAGGCCAAAATTCAGAGGCAGGGAGTCACATGCCAAATGATGCAAATGAAAATGGACATT
TGCATCATGATATTATGGAAAATGGAAAGGGGAATGAACAACTGAAACCAACCCCTCAAACCGGGAAGAAGAGATCTAGT
ACTAATACCAAAATTTCAGGGTCGCATCGTGAACTTGTCATTGGTCTTCCTTGCCGCGGGCAATTTGAAATCCATCGGTC
CAGGTCATCTACGAGTTCGAAGAGGTTAGGAGGAGGTGGAGAAAGGAATGTGTTGTTTTCAAGTCACAAGGGAGCTCAGA
GATCTAAGGAAGATGCTGGATCATCTTCGGTTGCTGCTAATTCCACACCTGTAGGTCGACCAAAGAAAAGGAATAAGACT
ATGAAGAAAGGAGAAGTTAGAGAAGATGATGAGTACACAAGAATCAAAAAGAAACTTCGATACTTTCTAAACCGGATTAG
CTATGAGCAAAACCTAATTGACGCCTATTCTTTAGAAGGCTGGAAAGGTTCAAGCCTGGAAAAGATAAGGCCAGAGAAAG
AGCTTGAACGAGCCACAAAGGAAATTTTGCGGCGCAAGCTTAAAATTAGAGATCTTTTTCAGCACCTTGACACACTCTGT
GCTGAAGGAAGCCTTCCAGAGTCTTTATTTGATTCTGATGGAGAGATTTCTAGCGAGGATATCTTTTGTGCAAAATGTGG
TTCAAAGGACTTGTCTGTTGATAATGATATCATACTATGTGATGGGTTTTGCGATCGAGGCTTTCACCAATACTGTCTTG
AACCACCTCTGCGGAAAGAAGATATTCCTCCGGATGATGAGAGTTGGCTATGCCCCGGATGTGATTGCAAAGATGACAGC
TTGGACTTGCTTAATGATTCTTTAGGGACAAAACTTTTGGTCAGCGACAGTTGGGAGAAAATATTTCCTGAGGCTGCAGC
AGCGTTGGCTGGTGGAGGTCAAAATCTTGACTGTGATCTTCCTTCAGATGATTCTGATGATGAAGAGTATGATCCAGATG
GTTTGAATGATAATGAAAATGATGAAGATGGCAGTGATGACAATGAAGAATCTGAGAACGAAGATGATAGTTCTGATGAA
TCTGAATCTACATCTGCATCTGACAAAATGATCGAGTCATTTAAAGAAGGGAAAGATATAATGAAAGATATAATGGCCCT
TCCATCTGATGATTCTGAGGATGATGACTATGATCCTGATGCCCCGACTTGTGATGAAGATAAAGAAAGTTCAAATTCTG
ATTGTACATCAGACTATGAAGATCTTGAAACTTCCTTCAAAGGAGATGAGTCTAATCAGCAAGCTGAAGATACACCATTT
GAGGATCCTGGCAGACAGACGTCTCAGCTCCCGTGTGATGCAATTTTAGAGTCAGATGTTGGGCTTGATGATGGTCCTGC
CGGTGTATCCAGAAGGAGGAATGTTGAAAGACTGGATTACAAAAAGTTGTATAATGAGGAATATGACAATGTTCCGACTT
CGTCAAGTGATGATGACGATTGGGATAAAACTGCAAGAATGGGAAAAGAAGATTCCGAGTCAGAAGATGAAGGGGACATT
GTACCTCTGAAACAGTCTTCAAATGCAGAAGATCATACTTCTAAGAAACCTAGACGGAAGTCGAAAAGGACAGATAAAAA
GGATACCTTGGAAGTGCCACAAGAATGTCCTGGAGAAAATGGTGGTTCTGGTGAAATTGAAAAAAGCAGCTCTTCAGCAA
ATAAACAGACAGATCCCAAAACTCAGAGATTATACATATCTTTTCAAGAAAATCGATATCCAGACAAAGCCACGAAGGAG
AGCTTAGCCAAAGAGCTACAAATGACAGTTACGCAAGTTAATAACTGGTTTAAGAATAGGCGTTCGTCGATAAACAGCAA
ACCTTTAGTTTCTGAGGAAAATGTCGAGAAGTTAAAAACAGGTAAGGAAGGTGAATGTGAGACATCTGTTGCTGGAAGTA
GCGTACAAACTATGGAAACTGAGTCAGTTGCAGAGAATAAGAGCAGGGCATCGGAATCAACCAATACTGGATCGCGGAAA
AGAAGAAGAAAGTAA