Details for Lyrate rockcress Locus 16061510

Position : sca3 ( 5`- 2581899 .. 2580315 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16061510

Protein [Map View]
MASMSLSFSSSLCSSRIPEGKRRFRHRDASFVRCVLAASKSSPGSVTKKRLWKDGEFPGITEPVNPRRTPIKNVKKKLDR
RSKANGWANTVTETLSDLIAKKQWLQALEVFDMLREQTFYQPKEGTYMKLLVLLGKSGQPNRAQKLFDEMLEEGLEPTVE
LYTALLAAYTRSNLIDDAFSILDTMKGLPQCQPDVFTYSTLLKACVDASQFDLVDSLYKEMDERLITPNTVTQNIVLSGY
GRVGRFDQMEKVLSDMLVSTACKPDVWTMNIILSVFGNMGKIDMMESWYEKFRNFGIEPETRTFNILIGSYGKKRMYDKM
SSVMEYMRKLEFPWTTSTYNNIIEAFADVGDAKNMELTFDQMRSEGMKADTKTFCCLINGYANAGLFHKVISSVQLAAKF
EIPENTAFYNAVIAACAKADDLIEMERVYTRMKERQCVCDSRTFEIMVEAYEKEGMNDKIYYLEQERQKLMDRAVATKEM
ENLPAG*

DNA
ATGGCGTCGATGTCTCTCTCCTTTTCTTCTTCGCTATGTTCGTCTCGAATTCCCGAAGGAAAGCGTAGGTTTCGTCACAG
AGATGCGAGCTTCGTACGATGCGTTTTGGCTGCTTCTAAATCTTCTCCGGGAAGTGTTACGAAGAAGAGGCTTTGGAAAG
ACGGCGAATTTCCCGGAATCACGGAACCTGTTAATCCGAGAAGAACTCCGATTAAGAATGTGAAGAAGAAACTTGACAGG
AGAAGCAAAGCTAACGGATGGGCTAACACCGTCACTGAAACTTTGTCCGATCTCATCGCCAAAAAGCAGTGGTTACAAGC
TCTTGAGGTTTTTGATATGTTGAGGGAACAAACGTTTTATCAACCAAAGGAAGGAACTTACATGAAGCTGCTTGTTCTTC
TGGGGAAATCTGGTCAACCCAATCGAGCACAGAAGCTGTTCGACGAAATGCTTGAAGAAGGACTTGAACCAACTGTTGAA
CTCTACACTGCTCTTCTCGCTGCTTACACTCGTAGCAATCTCATCGACGATGCTTTTTCAATTCTTGATACAATGAAAGG
CTTGCCTCAATGCCAACCTGATGTTTTCACGTACAGCACTCTGCTCAAGGCGTGTGTGGATGCTTCTCAGTTTGACTTGG
TGGATTCGTTATACAAGGAAATGGACGAGCGTTTGATAACTCCAAACACTGTTACCCAGAACATAGTTTTAAGTGGGTAC
GGTAGGGTCGGAAGGTTTGATCAGATGGAGAAAGTTTTGTCTGATATGCTGGTGAGTACTGCTTGCAAACCCGATGTGTG
GACTATGAATATCATCCTTAGTGTGTTTGGGAACATGGGTAAGATAGACATGATGGAGAGCTGGTACGAAAAGTTCAGGA
ACTTCGGGATTGAGCCAGAGACTCGTACTTTCAATATTTTGATTGGTTCTTATGGGAAGAAGAGAATGTACGATAAGATG
TCGTCTGTCATGGAATACATGCGGAAGCTTGAGTTTCCATGGACAACATCGACCTACAACAATATCATCGAGGCGTTTGC
GGATGTTGGCGATGCAAAGAACATGGAGTTGACATTTGATCAGATGCGTAGCGAAGGTATGAAAGCAGACACAAAGACCT
TTTGCTGTCTCATAAATGGATATGCCAATGCCGGTCTTTTTCACAAGGTCATAAGTAGTGTCCAGTTGGCTGCTAAGTTT
GAGATACCCGAGAATACTGCCTTTTACAACGCGGTTATAGCAGCATGCGCTAAAGCCGATGATCTGATAGAGATGGAAAG
AGTGTACACAAGAATGAAGGAGAGACAATGCGTATGTGATTCAAGAACGTTTGAGATCATGGTCGAGGCATATGAAAAGG
AAGGTATGAATGATAAGATATATTACTTGGAACAAGAGAGGCAAAAGCTTATGGATCGCGCTGTAGCTACAAAAGAGATG
GAGAATCTTCCAGCAGGATGA