Details for Lyrate rockcress Locus 16061505

Position : sca3 ( 5`- 7974912 .. 7975499 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16061505

Protein [Map View]
MERSTPEHVSSAHKRLSVSFLVSLMVNCARHASRVSKKLKPKTSRKQTHLEDYLESPKSNGNGGEDDRGGGRFGWSPART
FSPMRVRPKELYTTLSNKAMTMVGRKNKAYNGGPTKKTAVEMVIEEDEEEYGVWQREILMGGKCEPLDYSGVIYYDCSGH
QLREVPPRSPRASLVPERQTRSYVGSLLNPTGKEI*

DNA
ATGGAGAGATCAACGCCGGAACATGTCTCCTCCGCACACAAGCGCCTAAGTGTGAGCTTCCTCGTATCTCTCATGGTAAA
TTGTGCTAGACACGCAAGCAGAGTTTCCAAGAAGCTTAAACCTAAGACGAGTCGGAAGCAAACTCATCTCGAAGACTATC
TCGAAAGCCCTAAGTCTAACGGAAACGGTGGCGAAGACGACAGAGGAGGAGGAAGGTTTGGATGGAGTCCCGCACGGACT
TTTTCTCCGATGAGGGTGCGTCCTAAGGAGCTTTATACGACCTTGAGCAACAAGGCGATGACTATGGTTGGCCGGAAAAA
CAAAGCTTACAACGGTGGTCCGACGAAGAAGACGGCGGTGGAGATGGTGATAGAGGAGGATGAGGAGGAGTACGGCGTTT
GGCAGAGGGAGATTTTGATGGGAGGAAAATGTGAGCCGTTGGATTACTCCGGCGTGATCTACTACGATTGTAGTGGACAT
CAGCTAAGAGAAGTGCCTCCAAGGTCGCCACGTGCCAGTTTGGTTCCGGAGCGCCAGACCCGTTCTTATGTCGGGTCACT
GTTAAACCCGACCGGAAAAGAAATTTAA