Details for Lyrate rockcress Locus 16061487

Position : sca3 ( 5`- 4443555 .. 4445226 -3` )
Annotation : [B2G] ATFER2 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16061487

Protein [Map View]
MLLKASPALSLLSSTGGGNLFPPSRNSSNLLFSPSGSRFSVQAAKGTNTKSLTGVVFEPFEEVKKELELVPTTPFVSLAR
HKFSDDSESAINDQINVEYNVSYVYHALYAYFDRDNVGLKGFAKFFNDSSLEERGHAEKFMEYQNMRGGRVKLQSILMPV
SEFDHEEKGDALHAMELALSLEKLTNEKLLKLQSVGVKNNDVQLVDFVESEFLGEQVEAIKKISEYVAQLRRIGKGHGVW
HFDQMLLNEV*

DNA
ATGTTGCTCAAGGCTTCTCCCGCTCTCTCTCTCTTGAGCTCCACCGGCGGTGGAAATCTCTTTCCGCCGTCGAGAAATTC
GTCGAATCTTCTGTTTTCTCCGAGTGGATCTAGGTTTTCTGTTCAGGCGGCGAAAGGAACCAACACGAAGTCGTTAACCG
GAGTTGTATTCGAACCTTTTGAGGAGGTGAAGAAAGAACTGGAGCTCGTTCCCACTACCCCTTTTGTTTCTCTCGCTCGC
CACAAGTTCTCTGACGATTCAGAATCTGCCATCAACGATCAGATCAATGTGGAGTACAATGTCTCCTATGTCTACCATGC
CCTGTATGCTTACTTTGACAGAGACAATGTCGGCTTGAAAGGTTTCGCCAAGTTCTTTAACGATTCGAGTCTTGAAGAAC
GAGGTCATGCTGAGAAGTTTATGGAGTATCAGAACATGCGCGGTGGGAGAGTGAAGCTGCAGTCTATTTTGATGCCCGTC
TCTGAGTTTGATCACGAGGAGAAGGGAGATGCATTGCATGCGATGGAGCTTGCACTGTCTTTGGAGAAACTTACTAATGA
AAAGCTTCTGAAGTTGCAAAGTGTTGGTGTGAAGAACAATGATGTTCAGCTGGTTGATTTTGTAGAATCCGAGTTTCTCG
GCGAGCAGGTTGAAGCCATCAAGAAAATCTCAGAGTACGTTGCACAGCTAAGAAGAATAGGAAAGGGTCATGGAGTGTGG
CATTTTGATCAAATGCTTCTCAATGAGGTTTAA