Details for Lyrate rockcress Locus 16061454

Position : sca3 ( 5`- 22210375 .. 22211094 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16061454

Protein [Map View]
MKKQIMDESEKSLMPPPPPPLPPSPGYGFRKIHGDSITNKQIKKFWRQKQIIEEDHLYSAIKAAARVRARNLSDEDYKRF
EESLDMEDLKTEDHQGLKDWWTKSKYAYLNQPALGYADSLKRKRFSTYTPNCFSFKPCNPLYATSLNVF*

DNA
ATGAAGAAACAGATTATGGATGAGTCTGAGAAGTCATTGATGCCGCCTCCTCCTCCACCGCTTCCTCCATCTCCGGGATA
TGGATTTAGAAAGATCCATGGAGACAGCATAACCAATAAACAGATCAAGAAGTTCTGGAGACAAAAGCAGATTATTGAAG
AGGATCATCTATATTCTGCTATTAAGGCTGCAGCTCGTGTCAGAGCTCGTAATCTCTCTGATGAGGATTACAAACGCTTT
GAAGAAAGCTTGGACATGGAGGACCTGAAAACTGAAGATCATCAGGGATTGAAAGACTGGTGGACAAAGAGCAAATACGC
ATACTTGAACCAGCCCGCTCTTGGATATGCAGATTCACTGAAGAGAAAGAGGTTTTCAACATATACACCAAACTGTTTCT
CGTTCAAGCCTTGCAATCCACTCTACGCAACTTCGCTCAATGTCTTTTGA