Details for Lyrate rockcress Locus 16061433

Position : sca3 ( 5`- 9261821 .. 9262336 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16061433

Protein [Map View]
DDSETVAMIKELLETRIRPAVQDDGGDIEYCGFDPESGIVKLRMQGACSGCPSSSVTLKSGIENMLMHYVSEVKGVEQEF
DGEDEEGTLSGEVRVE*

DNA
GATGACTCTGAAACCGTAGCAATGATCAAGGAACTCTTAGAAACACGCATCAGACCAGCAGTCCAAGATGATGGTGGGGA
CATTGAGTATTGTGGGTTTGATCCGGAAAGCGGTATAGTGAAGCTGAGGATGCAAGGAGCTTGTAGTGGTTGTCCGAGCT
CATCGGTTACTTTGAAATCGGGAATCGAAAACATGCTAATGCATTATGTATCCGAGGTGAAAGGTGTAGAACAAGAGTTC
GATGGGGAAGATGAAGAGGGAACATTGTCTGGAGAGGTGAGAGTAGAGTAA