Details for Lyrate rockcress Locus 16061431

Position : sca5 ( 5`- 17965361 .. 17964765 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_324164 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16061431

Protein [Map View]
MEPTHKALPVGFRFRPTNCEIANYFLKKKALGQPMKARTVPEECHDVFSRHPRDFPGYPKEEHWYYFCRKRNNQVTSNSP
NLWTPIGEETNVLDPKNNGALVGIKRRLTLIAQEEESDNICLSDEEEAPKYNWFMDEISLPQTVADTDWVLCHIFGKTIK
PIFTESE*

DNA
ATGGAGCCAACACACAAAGCTTTGCCCGTAGGATTCAGGTTTCGTCCTACAAACTGTGAGATTGCAAACTATTTCTTGAA
GAAAAAAGCTTTAGGACAACCCATGAAAGCTCGTACGGTACCTGAAGAGTGTCATGATGTCTTCTCGAGACATCCTCGTG
ATTTTCCTGGCTATCCAAAAGAAGAGCACTGGTACTATTTTTGCAGAAAACGTAACAACCAAGTTACTAGTAACTCTCCT
AATCTCTGGACACCAATCGGAGAAGAAACTAATGTGTTAGATCCAAAGAATAATGGTGCCTTAGTCGGTATCAAACGTCG
GCTTACTCTCATTGCGCAAGAAGAAGAATCTGATAATATTTGTTTGTCTGATGAAGAAGAAGCTCCAAAGTATAACTGGT
TCATGGATGAAATTAGCCTCCCACAAACAGTAGCAGATACTGATTGGGTTTTATGCCATATTTTTGGCAAGACGATTAAA
CCCATATTTACTGAATCCGAATAG