Details for Lyrate rockcress Locus 16061418

Position : sca3 ( 5`- 616368 .. 617468 -3` )
Annotation : [B2G] s-adenosylmethionine decarboxylase
External links : CoGe
PGDD synteny : 16061418

Protein [Map View]
MALSAIGFEGYEKRLEVTFFEPSIFQDSKGLGLRALTKSQLDEILTPAACTIVSSLSNDKLDSYVLSESSFFVYPYKVII
KTCGTTKLLLSIPPLLKLAGELSLSVKSVKYTRGSFLCPGGQPFPHRSFSEEVSVLDGHFTQLGLNSVAYLMGNDDETKK
WHVYAASAQDSSNCNNNVYTLEMCMTGLDREKASVFYKNEADKTGSMTDNSGIRKILPQSQICDFEFEPCGYSMNSIEGD
AISTIHVTPEDGFSYASFEAVGYDFNTIDLSQLVTRVLSCFEPKQFSVAVHSSVGVNAYKPEISVDLEDYGCRERTFESL
GEESGTVMYQTFEKLGKYCGSPRSTLKCEWSSNNSCSSEDEKDEGI*

DNA
ATGGCCTTATCTGCAATCGGTTTCGAAGGTTACGAGAAACGGCTCGAGGTTACTTTCTTTGAGCCAAGCATCTTTCAAGA
CTCCAAGGGACTGGGACTCCGTGCTCTTACCAAGTCTCAGCTTGATGAAATTCTTACACCTGCTGCATGCACGATCGTTT
CTTCTCTCTCCAACGATAAATTGGACTCTTACGTACTCTCTGAGTCCAGCTTCTTTGTCTACCCCTACAAAGTCATCATC
AAGACTTGCGGTACCACAAAGCTCCTCCTCTCTATCCCACCACTTCTAAAGCTGGCTGGTGAGCTCTCTCTGAGTGTCAA
GTCTGTGAAGTACACTCGTGGCTCCTTCCTCTGCCCCGGAGGCCAGCCTTTCCCTCACCGCAGCTTCTCTGAAGAAGTCT
CTGTTCTTGATGGGCACTTTACTCAGCTGGGCTTGAACAGCGTAGCCTACTTGATGGGCAATGATGATGAGACTAAGAAA
TGGCATGTCTATGCTGCCTCTGCCCAGGACTCCAGCAACTGCAACAACAATGTCTACACTCTCGAGATGTGCATGACTGG
TCTGGACAGAGAGAAAGCTTCTGTCTTCTACAAGAATGAAGCTGACAAGACTGGGTCAATGACTGACAACTCTGGAATCC
GAAAGATCCTTCCCCAGTCCCAGATCTGCGACTTTGAATTCGAGCCCTGTGGCTACTCTATGAACTCAATTGAAGGGGAT
GCAATCTCCACGATCCATGTGACCCCTGAAGATGGGTTTAGCTACGCTAGCTTTGAAGCTGTGGGTTACGACTTCAACAC
TATTGACCTGAGCCAGCTGGTGACAAGGGTACTCTCTTGCTTCGAGCCCAAGCAATTCTCTGTAGCTGTGCACTCGAGCG
TTGGAGTGAACGCATACAAGCCAGAGATCAGTGTAGACTTGGAAGACTATGGGTGCAGAGAGAGGACATTCGAGTCTCTA
GGAGAAGAGAGTGGAACAGTGATGTATCAGACGTTTGAGAAGCTTGGTAAGTACTGTGGATCGCCTAGATCTACCTTGAA
GTGTGAATGGAGCAGCAACAATAGCTGCAGCAGCGAGGACGAGAAGGACGAGGGAATCTAG