Details for Lyrate rockcress Locus 16061411

Position : sca3 ( 5`- 2925747 .. 2928845 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478019 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16061411

Protein [Map View]
MLARAPPPCLNFPSRSNICNRREIVRLFRNGGSGGVVARAGFVRRPLETSSSYDDSTDEGFVIISSVDKENEFSPPPTPD
LLSSIPSESTRRNGSRSGGVTASFGRLKAQKVKALVGKVTQKKQHMSHNEEEDEDDASDAEDYSADEGFGSSSILDLMRK
KLAMKAIPRAGKSAEIKEVKRVSKVRESRESSRDLDRLEGDDEDVYEVSNPDRFTDNERAGSRSSYSKGYAANSRGKGDR
LLVARDFDSFEGHDRAIDEVSNPRKFNDNERAGSRSSYSRDSSANSRGREDRRFVAKESNTFQGRDKAYDEVYYPRRFTD
NERGGSHSSYSKGSDTNSRGWGDRRSVVYARDMDDWRENRNKTNATRETGFFSRKTFAEIGCSEDMMKALKEQNFDRPAH
IQAMAFSPVIDGKSCIIADQSGSGKTLAYLVPAIQRLREEELQGQSKSSSGCPRVIVLVPTAELASQVLANCRSISKSGV
PFRSMVVTGGFRQRTQLENLEQGVDVLIATPGRFMYLMNEGILGLSNLRCAILDEVDILFGDDEFEAALQSLINSSPVTA
QYLFVTATLPLEIYNKLVEVFPDCEVVMGPRVHRVSNALEEFLVDCSGDDNAEKTPETAFQNKKTALLQIIEENPVSKTI
IFCNKIETCRKVENIFKRVDRKERQLHVLPFHAALSQESRLTNMQEFTSSQPEENSLFLVCTDRASRGIDFSGVDHVVLF
DFPRDPSEYVRRVGRTARGARGEGKAFIFVVGKQVALARRIIERNQKGHPVHDVPNAYEFTT*

DNA
ATGTTGGCCAGAGCTCCACCACCGTGTTTGAACTTCCCGTCGAGGAGTAATATCTGTAATCGGAGGGAGATTGTGCGTTT
ATTTCGTAACGGCGGAAGCGGAGGAGTGGTAGCCAGAGCCGGTTTCGTTCGGCGGCCACTGGAAACTTCGAGTTCGTACG
ACGATTCCACCGATGAAGGATTCGTTATCATCAGTTCGGTGGATAAGGAGAATGAGTTCTCTCCTCCGCCTACTCCCGAT
TTACTCTCTTCGATTCCGTCAGAATCTACGAGAAGAAATGGTTCGCGGTCGGGAGGAGTAACTGCAAGTTTTGGAAGGCT
AAAGGCACAGAAAGTGAAAGCTCTTGTTGGAAAGGTAACGCAGAAGAAGCAGCATATGAGTCACAATGAGGAAGAAGACG
AGGATGACGCCTCTGATGCAGAGGATTATTCTGCGGATGAAGGGTTTGGTTCATCATCAATTCTGGATTTGATGAGGAAG
AAGCTGGCTATGAAGGCTATTCCTAGAGCAGGAAAATCTGCAGAGATAAAGGAGGTGAAAAGAGTTAGCAAAGTGCGGGA
ATCTAGAGAGTCAAGTAGAGATTTAGATAGATTGGAAGGAGATGATGAAGATGTTTATGAGGTTTCAAATCCTGACAGGT
TTACTGATAATGAGAGAGCAGGGTCGCGGAGTTCATATTCAAAAGGTTATGCTGCTAACTCCAGGGGTAAGGGCGATAGG
CTTTTGGTTGCAAGAGATTTTGATTCATTTGAAGGACATGATAGAGCTATTGATGAGGTTTCAAACCCTCGAAAGTTTAA
TGATAACGAGAGAGCAGGATCGCGGAGTTCATATTCAAGAGACTCTTCCGCTAACTCAAGGGGTAGAGAAGATAGGCGTT
TTGTTGCCAAAGAGTCAAATACATTTCAGGGACGTGATAAAGCTTATGATGAGGTTTATTATCCTCGAAGATTCACTGAT
AATGAGAGAGGAGGATCACATTCATCATATTCAAAAGGCTCTGATACTAACTCCAGGGGTTGGGGCGATAGGCGTTCTGT
TGTATATGCAAGAGATATGGATGATTGGAGAGAGAATAGGAATAAAACCAATGCTACTAGAGAGACTGGCTTTTTTAGCC
GGAAAACTTTTGCAGAAATTGGATGTAGTGAAGATATGATGAAGGCCTTAAAGGAACAGAATTTTGACCGCCCGGCACAT
ATTCAGGCTATGGCTTTTTCACCAGTTATTGATGGAAAGAGTTGTATCATAGCTGACCAAAGTGGATCAGGCAAGACACT
GGCATATCTTGTCCCTGCTATTCAGCGTCTCAGAGAAGAAGAACTTCAAGGACAGAGCAAATCGTCTTCTGGGTGTCCTC
GTGTTATTGTTCTGGTACCGACTGCAGAGTTGGCTTCCCAGGTTCTTGCTAACTGTAGATCAATATCAAAGTCTGGGGTC
CCGTTCCGTTCCATGGTAGTGACGGGTGGCTTCAGACAACGAACCCAGCTAGAAAATTTAGAGCAAGGTGTTGACGTTTT
GATTGCAACACCTGGGCGTTTCATGTACCTAATGAACGAAGGAATATTGGGGTTGTCAAATTTAAGATGTGCCATCTTGG
ATGAGGTGGATATACTCTTTGGCGACGATGAATTTGAGGCAGCCCTGCAAAGTTTGATAAACTCTTCTCCTGTTACTGCA
CAGTATCTATTTGTTACAGCAACCTTGCCACTTGAGATATACAACAAACTTGTTGAAGTTTTCCCTGATTGTGAAGTTGT
AATGGGACCTCGAGTGCACCGTGTTAGTAATGCTCTCGAAGAGTTTCTTGTCGACTGTAGTGGAGATGATAATGCAGAGA
AAACTCCTGAGACTGCTTTTCAGAACAAGAAAACTGCTCTCCTTCAGATTATCGAGGAAAACCCTGTTTCCAAAACTATT
ATCTTCTGCAATAAGATTGAGACATGTAGGAAAGTTGAGAATATATTTAAGCGGGTTGATAGAAAGGAAAGACAGTTGCA
CGTCCTACCTTTTCATGCTGCACTCTCACAAGAATCAAGGCTTACAAACATGCAAGAATTCACATCATCGCAACCCGAAG
AAAATTCACTGTTTCTGGTTTGCACGGATAGAGCCTCCCGTGGGATAGATTTCTCTGGTGTTGATCATGTGGTGCTCTTT
GACTTCCCACGTGACCCGAGTGAATACGTGAGACGTGTTGGAAGAACAGCAAGAGGGGCTAGAGGAGAAGGAAAGGCTTT
CATCTTTGTGGTGGGGAAGCAAGTAGCGTTGGCACGGAGGATAATTGAGCGAAATCAGAAAGGTCACCCAGTTCATGATG
TCCCAAACGCTTACGAGTTCACAACTTAA