Details for Lyrate rockcress Locus 16061405

Position : sca3 ( 5`- 4205970 .. 4204730 -3` )
Annotation : [B2G] non-symbiotic hemoglobin 2
External links : CoGe
PGDD synteny : 16061405

Protein [Map View]
MGEIGFTEKQEALVKESWEILKQDIPKYSLHFFSQILEIAPAAKGLFSFLRDSDEVPHNNPKLKAHAVKVFKMTCETAIQ
LREKGKVVVADTTLQYLGSIHLKSGVIDPHFEVVKEALLRTLKEGLGEKYNEDVEGGWSQAYDHLALAIKTEMKQEDQS*

DNA
ATGGGAGAGATTGGGTTTACAGAGAAGCAAGAAGCTTTGGTGAAGGAATCGTGGGAGATACTGAAACAAGACATCCCCAA
ATACAGCCTTCACTTCTTCTCACAAATATTGGAGATAGCACCAGCAGCAAAGGGCTTGTTCTCTTTCCTAAGAGACTCAG
ATGAAGTCCCTCACAACAATCCTAAACTCAAAGCTCATGCTGTTAAAGTCTTCAAGATGACATGTGAAACAGCTATACAG
TTGAGGGAGAAAGGAAAGGTGGTAGTAGCTGACACAACTCTACAATACTTGGGCTCAATTCATCTCAAAAGCGGCGTTAT
TGACCCTCACTTCGAGGTGGTGAAAGAAGCTTTGCTAAGGACATTGAAAGAGGGGTTGGGGGAGAAATACAACGAAGATG
TGGAAGGAGGTTGGTCTCAAGCTTATGATCACTTGGCTTTAGCCATTAAGACCGAGATGAAACAAGAAGATCAGTCATAA