Details for Lyrate rockcress Locus 16061352

Position : sca3 ( 5`- 7762710 .. 7764850 -3` )
Annotation : [B2G] peroxin-3 family protein
External links : CoGe
PGDD synteny : 16061352

Protein [Map View]
MDLVRGFWRKHRRKILVTTTCLGSGYLLYKLYNAHTRKLADLERELAYERENDEIIKTQMKAHFDNIQMIADTTTLPHAM
HHLSSRLVEEIDVSSIMDKLSKGKGILIPSEKLHLWNELKILSFTRMVLSLWSVTMLSLYIRVQVNILGRHLYIDTARGL
GSSHLLEELDLIDRDDEQKFLASADFLATSGIPSLISNMQGAVKEVLKGKQLKDVFTTRVLQETVMRILDVFMSTGSPHH
WVDYLMMSQDATSDVSSSDATVTKFHQLITETREVVTSNDFTNVAEISLKCCAVALVEEMETQTALAKGMQLAKLLPQIE
KTMPEISAEPSKNRFLQLIRDLPEVKLFFTLLYANMPQ*

DNA
ATGGATTTAGTCAGGGGTTTCTGGAGGAAACATAGAAGGAAGATTTTGGTGACGACGACTTGTTTGGGAAGTGGGTATTT
ACTCTACAAACTATACAATGCTCATACTCGTAAGCTCGCTGATTTGGAACGAGAGCTTGCTTATGAGCGTGAAAATGACG
AGATCATCAAAACCCAAATGAAGGCCCATTTCGATAACATTCAGATGATTGCTGATACTACTACATTGCCTCACGCAATG
CATCACTTGAGTAGCCGTTTAGTTGAAGAGATTGATGTCTCTAGTATTATGGATAAGCTAAGCAAAGGAAAAGGAATATT
GATTCCTTCTGAGAAGCTTCATCTCTGGAATGAGCTCAAAATTTTGAGTTTCACGAGGATGGTTTTGTCGCTTTGGTCTG
TCACTATGCTTAGTTTGTACATTAGGGTTCAAGTCAATATTTTGGGCAGACATTTATATATCGACACTGCTAGAGGTCTT
GGGAGCTCCCATTTACTTGAAGAACTAGATCTCATAGATAGAGATGACGAACAAAAGTTTTTGGCAAGCGCTGATTTTCT
TGCGACTAGTGGCATACCGAGTTTGATTTCTAATATGCAGGGTGCAGTGAAAGAAGTTCTAAAGGGAAAGCAGTTGAAGG
ATGTGTTTACCACAAGGGTTCTTCAAGAAACTGTGATGCGGATTCTCGATGTGTTTATGAGCACTGGAAGTCCACATCAC
TGGGTAGATTATCTGATGATGTCCCAAGACGCAACCAGTGATGTTTCCTCTTCTGATGCAACTGTTACCAAGTTTCATCA
ACTCATAACCGAGACACGGGAAGTAGTCACAAGCAATGATTTTACAAATGTAGCAGAGATCTCACTCAAGTGTTGTGCCG
TGGCGTTAGTAGAGGAGATGGAAACACAGACCGCTTTAGCCAAAGGGATGCAATTGGCGAAGCTATTACCACAGATTGAG
AAGACCATGCCAGAGATTTCAGCTGAACCAAGCAAGAACCGGTTCTTGCAACTCATCCGAGATTTGCCTGAAGTTAAACT
CTTTTTTACTCTTTTATACGCAAATATGCCTCAGTAG