Details for Lyrate rockcress Locus 16061344

Position : sca3 ( 5`- 6533655 .. 6532706 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479001 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16061344

Protein [Map View]
MGKTAGNRDWTQIYAIYGIEQWQTLVFLLFHAFFFSLLSVLFLIYFDQICFFLDSFFLSGAARLAAGFTGAVTALSAVCL
LFAAANFVYSDVPLQYEMAQRMVSSVGDWSCVKTALDLGCGRGILLNAVATQLKKTGSSGRVVGLDRSKRTTLSTLRTAK
LEGVQEYVTCREGDVKTLPFGDNYFDVVVSSVFVHTVGKEHGQKSVEAAAERMRVLGEIVRVVKPGGLCVVWDLLHVPEY
VRRLQELKMENIRVSERVTAFMAGSHIVSFRKPSELVAGPREVRLDWR*

DNA
ATGGGTAAAACCGCCGGAAACAGAGATTGGACTCAGATCTACGCTATTTACGGAATCGAACAATGGCAGACACTCGTCTT
CCTTCTCTTCCATGCTTTTTTCTTCTCACTCCTCTCTGTTCTCTTCCTCATCTACTTCGATCAGATTTGCTTCTTCCTCG
ATTCCTTCTTCCTCTCCGGCGCCGCCAGGTTAGCCGCGGGTTTCACTGGCGCTGTTACCGCTCTCTCCGCGGTTTGTCTA
CTCTTCGCCGCCGCTAATTTCGTTTACTCCGATGTTCCGCTACAGTACGAGATGGCTCAACGCATGGTTAGCTCCGTCGG
TGACTGGTCTTGTGTCAAAACTGCTCTCGATCTCGGTTGTGGCCGTGGTATCCTCCTCAATGCCGTCGCTACACAGCTTA
AGAAAACCGGTAGCTCCGGTCGGGTCGTCGGGTTAGACCGCTCTAAACGCACAACTCTCTCCACTCTCCGCACCGCTAAA
CTCGAAGGTGTGCAAGAGTATGTGACTTGCCGTGAAGGAGATGTTAAAACGTTACCGTTTGGGGATAATTACTTCGACGT
GGTGGTCTCGTCTGTGTTCGTTCACACGGTGGGGAAAGAGCATGGTCAGAAGTCGGTGGAGGCGGCGGCGGAGAGAATGA
GAGTGCTCGGAGAGATAGTTAGAGTTGTGAAGCCAGGAGGTTTGTGTGTGGTTTGGGATCTCTTACACGTGCCGGAGTAC
GTGCGGCGTCTTCAGGAGCTGAAGATGGAAAATATCCGAGTCTCCGAGCGAGTCACGGCGTTTATGGCCGGTAGCCACAT
CGTGTCGTTCCGGAAACCCAGTGAACTCGTCGCCGGACCCCGTGAAGTCCGCCTCGATTGGAGATGA