Details for Lyrate rockcress Locus 16061309

Position : sca3 ( 5`- 4507229 .. 4508600 -3` )
Annotation : [B2G] 60s acidic ribosomal protein p0
External links : CoGe
PGDD synteny : 16061309

Protein [Map View]
MVKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMMKRSVRIHSENTGNTAILNL
LPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPV
ELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAAP
HMFINAYKNALAIAVATDYTFPQAEKVKEFLKDPSKFVVAAAAVSADAGGGGAQAGAAAKVEEKKEESDEEDYEGGFGLF
DEE*

DNA
ATGGTGAAGGCAACGAAAGCAGAGAAGAAGATCGCGTATGACACAAAACTATGTCAGCTTATCGACGAATACACTCAGAT
CTTAGTCGTTGCGGCGGATAACGTCGGATCTACTCAGCTTCAGAACATCAGGAAAGGTCTCCGTGGAGACTCAGTGGTTC
TCATGGGTAAGAACACCATGATGAAACGTTCCGTTAGAATCCACTCCGAGAACACTGGAAACACTGCGATTTTGAATCTG
CTTCCTCTCCTTCAGGGAAATGTTGGTTTGATCTTCACTAAAGGTGATCTCAAGGAAGTGAGCGAGGAGGTTGCCAAATA
CAAGGTTGGTGCTCCTGCTCGTGTGGGTTTGGTTGCTCCAATTGATGTGGTTGTTCAGCCTGGCAACACTGGTCTCGATC
CATCTCAAACATCTTTCTTCCAGGTGCTTAATATCCCAACTAAGATTAACAAGGGTACTGTTGAAATTATCACCCCTGTG
GAGCTTATTAAGCAAGGTGACAAGGTTGGGTCTTCTGAGGCTGCCCTTTTAGCTAAGCTTGGCATTAGGCCTTTCTCGTA
TGGTCTAGTTGTTCAGTCGGTTTATGACAATGGCTCAGTCTTCAGCCCAGAGGTTCTTGATCTTACAGAAGATCAACTTG
TGGAGAAGTTTGCTTCTGGTATCTCTATGGTCACTTCCTTGGCTCTAGCTGTCTCTTACCCCACTCTTGCTGCTGCGCCG
CATATGTTCATCAATGCATACAAGAATGCCTTAGCTATTGCTGTTGCCACTGACTACACTTTCCCTCAAGCAGAGAAGGT
CAAGGAATTCTTAAAGGATCCCAGCAAGTTTGTTGTTGCTGCAGCGGCAGTGTCTGCGGATGCAGGTGGTGGTGGTGCTC
AAGCTGGAGCTGCTGCTAAGGTGGAGGAGAAGAAAGAAGAATCAGACGAAGAAGACTATGAGGGTGGTTTCGGTTTGTTC
GATGAAGAGTAG