Details for Lyrate rockcress Locus 16061106

Position : sca5 ( 5`- 17959187 .. 17960662 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_486090 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16061106

Protein [Map View]
MSHRVSILSSHFSPVSAVMASEKEAALAATPSDSPTIFDKIISKEIPSTMVYEDDKVLAFRDITPQGPVHILLIPKVRDG
LTGLSKAEERHIDILGRLLYTAKLVAKQEGLEEGFRIVINDGPQGCQSVYHIHVHLIGGRQMNWPPG*

DNA
ATGAGCCACCGTGTTTCGATTCTATCATCTCATTTCTCACCTGTCTCCGCCGTCATGGCTTCCGAGAAAGAAGCTGCTCT
CGCCGCCACTCCTTCCGATTCTCCCACCATATTTGACAAGATCATCAGCAAAGAAATTCCATCCACCATGGTTTATGAGG
ATGACAAGGTCTTAGCTTTTAGAGACATAACGCCCCAGGGTCCTGTTCACATCCTCCTTATTCCAAAAGTGAGGGATGGC
CTAACTGGACTCTCTAAGGCTGAGGAAAGGCACATCGACATCTTGGGCCGCCTTCTCTACACTGCTAAGCTCGTAGCGAA
ACAAGAAGGCCTAGAAGAGGGTTTCAGAATTGTGATCAATGATGGTCCACAAGGCTGTCAATCGGTGTATCACATTCATG
TTCATCTCATTGGAGGACGTCAAATGAACTGGCCTCCTGGCTAA