Details for Lyrate rockcress Locus 16061099

Position : sca3 ( 5`- 3371300 .. 3369874 -3` )
Annotation : [B2G] zinc finger family protein
External links : CoGe
PGDD synteny : 16061099

Protein [Map View]
MSDRILCKFFVHGSCLKGENCEFSHDSKDPPNNVCTFYQKGICLYGSRCRYDHVRAASNVPLSLDSESLDRSISTTPSRN
LQQQGTPDGDKSPNVHCIHPREYPICSFAAAGDCPRGNQCPHMHGDLCNTCGKKCLHPFRPEEREEHTKECEKMQKHIEA
LKQSQDIECSVCLDRILSKATPGERKFGLLTECDHPFCIQCIRNWRSSAPVSGMDVNSTLRACPICRKLSYFVVPSVVWY
STPEEKKEIIDIYKAKLRSIDCKHFNFGNGNCPFGASCFYKHAYSDGHLEEVVLRHLGSQEGETVITGSIRLSELLGGLQ
IF*

DNA
ATGTCCGATAGGATACTGTGCAAGTTCTTTGTCCATGGCTCGTGCTTGAAAGGCGAAAATTGTGAATTTTCCCATGATTC
TAAGGATCCGCCCAATAATGTTTGCACATTCTATCAGAAAGGAATATGTTTGTACGGAAGTAGATGTAGATACGATCATG
TCAGAGCTGCTTCCAATGTTCCTCTTAGCTTAGATTCTGAGTCTCTGGATCGCTCTATATCCACCACTCCCTCTAGGAAT
CTGCAACAACAAGGAACACCCGACGGTGATAAATCGCCTAACGTCCATTGTATCCACCCAAGAGAGTACCCGATCTGCTC
TTTTGCTGCAGCTGGTGATTGCCCTCGAGGAAACCAGTGTCCTCATATGCATGGAGACCTCTGCAATACTTGTGGCAAGA
AGTGTTTGCATCCTTTCAGACCCGAAGAACGAGAAGAGCACACTAAAGAATGTGAGAAGATGCAAAAGCACATTGAGGCT
TTGAAACAAAGTCAAGATATCGAGTGTAGCGTGTGTTTGGATCGTATCTTGTCAAAGGCTACTCCAGGGGAAAGGAAGTT
TGGGCTGTTGACCGAGTGCGATCATCCGTTTTGTATACAATGCATTCGTAATTGGCGCAGCAGTGCTCCTGTTTCGGGAA
TGGATGTCAACAGTACGTTAAGAGCTTGTCCTATATGTCGCAAACTCTCTTATTTTGTTGTCCCGAGTGTTGTCTGGTAC
TCTACTCCTGAAGAGAAAAAGGAAATTATCGACATATACAAGGCAAAACTCAGGTCAATCGACTGTAAGCACTTCAACTT
TGGAAATGGAAACTGCCCATTTGGAGCAAGTTGTTTCTATAAGCATGCATATTCTGATGGTCACTTGGAAGAAGTTGTTT
TACGGCATCTTGGTTCTCAAGAAGGTGAAACTGTAATAACTGGCAGTATCAGGCTATCAGAGTTGCTTGGAGGCCTGCAG
ATTTTCTAA