Details for Lyrate rockcress Locus 16061096

Position : sca3 ( 5`- 6643013 .. 6641873 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16061096

Protein [Map View]
MELVEETIPKEGKKMGERIVVDKAYLYQEDKPLTVCKTSLFYTGDGFAAYDCHGDIIFRVDSYGPDTRDNDEIVLMDATG
KCLLTVKRKRPTLHQRWEGFLGERSEGQKPIFSVRRSSIIGRCTMEVEVYDGTGEEYIIDGDFSQRSCLIYDTEKRTVAE
IKRKVDASTNVMLGRDVFTLEIKPGFDGAFAMGLVVVLDQINGDDPVEIGDEQVHPFVED*

DNA
ATGGAATTAGTTGAAGAGACCATTCCAAAAGAAGGGAAAAAGATGGGAGAAAGAATTGTGGTGGACAAAGCTTATCTCTA
CCAAGAAGACAAACCACTCACCGTCTGCAAGACTTCTCTCTTCTACACCGGCGATGGTTTCGCCGCCTATGATTGCCACG
GTGATATCATCTTCAGGGTTGATTCTTATGGACCTGACACAAGAGATAACGATGAGATTGTCCTCATGGACGCTACCGGA
AAGTGTCTCCTTACCGTTAAACGAAAGAGACCAACTCTACACCAAAGATGGGAAGGTTTTCTCGGAGAGAGATCGGAAGG
TCAGAAACCAATCTTCAGCGTTCGGAGATCTTCGATAATCGGACGGTGTACGATGGAAGTAGAAGTTTACGACGGAACAG
GAGAAGAGTACATTATTGATGGAGACTTCTCGCAACGAAGCTGTCTCATATACGACACGGAGAAACGTACTGTGGCTGAG
ATCAAACGCAAAGTAGACGCGTCAACGAACGTGATGCTTGGTCGAGATGTGTTCACTCTAGAGATTAAACCGGGTTTTGA
TGGCGCTTTCGCTATGGGTTTGGTCGTTGTGCTTGACCAGATCAACGGTGATGATCCAGTTGAGATCGGTGATGAACAGG
TACACCCTTTTGTAGAGGATTAA