Details for Lyrate rockcress Locus 16061087

Position : sca3 ( 5`- 9537132 .. 9534026 -3` )
Annotation : [B2G] 1-deoxyxylulose-5-phosphate synthase
External links : CoGe
PGDD synteny : 16061087

Protein [Map View]
MALSVFAFPSYIYRNPSIKYCKPTSMSSTKTSKVRATIAEKGEYYSSRPPTPLLDTINHPMHMKNLSIKELKVLSDELRS
DVIFNVSKTGGHLGSNLGVVELTVALHYIFNTPQDKILWDVGHQSYPHKILTGRRGKMKTIRQTNGLSGYTNRRESEHDS
FGTGHSSTTISAGLGMAVGRDLKGMNNSVVAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQVSLPTANLDGPTPP
VGALSCALSSGTGSTLFEELGFHYVGPVDGHNIDDLVSILEKVKSTKPIGPVLIHVVTEKGRGYPYAERADDKYHGVLKF
DPATGKQFKNISKTQSYTSCFVEALTAEAEADKNIVAIHAAMGGGTMLNLFESRFPTRCFDVGIAEQHAVTFAAGLACEG
LKPFCTIYSSFMQRAYDQVVHDVDLQKLPVRFAIDRAGLMGADGPTHCGAFDVTFMACLPNMIVMAPSDEAELFNMVATA
AAIDDRPSCFRYHRGNGIGVSLPPGNKGVPLQIGKGRILREGERVALLGYGSAVQRCLEAASMLSERGLKITVADARFCK
PLDVALIRSLVKSHEVLITVEEGSIGGFGSHVVQFLALDGLLDGKLKWRPMVLPDRYIEHGSPMDQLAEAGLTASHIAAT
ALNLMGTPREALFWE*

DNA
ATGGCTCTCTCCGTATTTGCCTTTCCTTCTTACATATATAGAAATCCTTCAATTAAATATTGCAAACCTACTTCTATGTC
TTCTACAAAAACTTCAAAAGTAAGAGCAACAATTGCAGAGAAAGGTGAATATTATTCAAGTAGACCACCAACTCCTTTAC
TGGACACAATCAACCATCCAATGCACATGAAAAATCTGTCCATCAAAGAACTCAAAGTTCTTTCGGACGAGTTGAGATCT
GATGTTATCTTCAATGTTTCAAAAACTGGAGGACACTTGGGTTCGAATCTGGGTGTTGTTGAGCTCACTGTGGCCCTTCA
TTACATCTTCAATACTCCTCAAGATAAGATCCTTTGGGATGTTGGTCATCAGTCTTATCCTCACAAGATTCTAACGGGAA
GAAGAGGTAAGATGAAGACAATAAGGCAGACCAATGGCCTCTCCGGCTACACCAATCGAAGAGAGAGTGAGCATGACTCC
TTTGGCACCGGGCACAGTTCGACCACAATATCTGCAGGCTTGGGGATGGCTGTGGGCAGGGATTTGAAGGGGATGAACAA
CAGCGTGGTTGCGGTTATAGGCGATGGTGCGATGACAGCTGGACAAGCTTATGAAGCAATGAACAATGCTGGCTACTTAG
ACTCCGACATGATTGTGATTCTCAACGACAATAAACAAGTCTCTTTGCCTACTGCTAACTTGGATGGACCAACTCCACCT
GTTGGAGCTTTGAGCTGTGCTCTAAGTAGTGGGACTGGTTCAACTCTGTTTGAAGAACTTGGTTTTCATTATGTTGGTCC
AGTTGATGGACACAACATAGATGATCTGGTCTCCATTCTTGAAAAAGTAAAAAGCACCAAACCCATAGGACCGGTTCTTA
TTCATGTCGTGACTGAGAAAGGTCGCGGATATCCCTACGCAGAGAGAGCTGATGACAAGTATCATGGAGTTTTAAAATTC
GATCCAGCAACAGGTAAACAGTTCAAAAACATTTCCAAGACTCAGTCTTACACTTCCTGTTTTGTGGAGGCCTTGACTGC
GGAAGCAGAGGCAGACAAAAATATTGTTGCCATTCATGCAGCCATGGGAGGTGGAACAATGTTGAATCTCTTCGAGAGCC
GCTTTCCTACAAGGTGTTTCGATGTTGGAATAGCAGAACAACATGCAGTTACTTTCGCTGCTGGTCTTGCTTGTGAAGGA
CTTAAGCCCTTTTGTACAATCTACTCATCTTTCATGCAACGGGCTTATGATCAAGTTGTACATGATGTTGATCTACAGAA
ACTACCAGTGAGATTTGCAATCGATAGAGCAGGACTTATGGGAGCAGATGGTCCAACACATTGTGGAGCATTTGATGTGA
CGTTTATGGCATGTCTTCCAAACATGATAGTTATGGCTCCATCTGATGAAGCAGAGCTTTTTAACATGGTTGCAACCGCT
GCAGCTATTGATGACCGTCCTTCTTGCTTTCGATATCATAGAGGAAACGGTATCGGTGTTTCACTTCCTCCTGGCAACAA
AGGTGTCCCTCTTCAGATTGGGAAAGGTAGGATACTAAGGGAAGGCGAGAGGGTTGCGCTTTTGGGCTACGGATCAGCCG
TTCAAAGATGTTTAGAGGCTGCTTCTATGCTTAGCGAACGTGGATTAAAGATAACTGTAGCGGATGCAAGATTTTGCAAG
CCATTAGATGTTGCTCTCATTCGTAGCTTAGTTAAATCACACGAGGTTTTGATCACGGTTGAAGAAGGTTCGATTGGAGG
ATTTGGATCGCATGTGGTACAATTTCTTGCACTTGATGGCCTTCTTGACGGAAAGCTCAAGTGGAGACCAATGGTACTAC
CTGACCGGTATATCGAACATGGATCACCAATGGATCAACTGGCTGAAGCTGGCCTCACAGCGTCTCACATTGCAGCCACA
GCACTTAACTTAATGGGAACACCTAGAGAAGCCTTGTTTTGGGAGTAA