Details for Lyrate rockcress Locus 16061052

Position : sca3 ( 5`- 1940333 .. 1942060 -3` )
Annotation : [B2G] zinc finger family protein
External links : CoGe
PGDD synteny : 16061052

Protein [Map View]
MAAKEIAGGSGSIDDGSDFDPCPICLGPFLHDSYLDTCFHKFCFNCIKQWIKVVSSKASKQLSSVKCPLCKTENFSIIHN
YDGCSFDRHYINRNIPDGFVLTKEQRYRLQCYYTESGFLADVFDVSRFWKLQKFLQPNRCLEAWLRRELQALMQEEDVDI
VMHHLVGVMDSFCKRIKQRRKLEARNAETTNQEQFKAAVSEAARPFVMVRTDRFVDELELFLAAGLNMEAYDAIYKQNRR
EIGAASEEREEVEEHNVRTRVTPYLFIFEEDSD*

DNA
ATGGCGGCGAAGGAGATCGCCGGCGGGAGCGGTTCTATTGACGACGGATCCGATTTTGATCCATGTCCTATTTGCCTTGG
ACCATTCCTCCATGATTCCTACCTTGATACCTGTTTCCACAAGTTTTGTTTCAATTGTATCAAACAATGGATCAAAGTTG
TTTCAAGCAAGGCCTCTAAGCAACTTTCCTCAGTGAAATGTCCTCTCTGTAAGACAGAGAATTTCTCCATCATCCACAAC
TACGATGGGTGTTCTTTTGACCGGCATTATATCAACCGGAATATTCCAGATGGTTTTGTATTAACAAAAGAACAGAGATA
CAGGTTGCAATGTTACTACACCGAATCAGGTTTCTTGGCTGATGTATTTGATGTTTCACGGTTTTGGAAGCTGCAAAAGT
TTCTCCAGCCAAACCGGTGCCTTGAAGCCTGGTTGAGGAGGGAGCTTCAAGCTCTAATGCAGGAGGAAGATGTTGATATT
GTTATGCATCATTTAGTCGGTGTGATGGATTCCTTCTGCAAAAGAATCAAACAGAGACGCAAACTAGAAGCAAGAAATGC
AGAGACGACAAATCAAGAACAATTCAAAGCAGCTGTCTCAGAAGCAGCACGTCCATTTGTAATGGTGAGAACAGACCGGT
TTGTGGATGAGCTTGAACTCTTCCTAGCAGCGGGACTGAACATGGAGGCTTATGATGCAATCTATAAGCAGAACCGAAGA
GAGATCGGTGCAGCTAGTGAAGAAAGAGAAGAAGTGGAAGAACATAATGTAAGAACAAGAGTGACTCCTTATTTGTTTAT
CTTCGAGGAAGACTCAGACTGA