Details for Lyrate rockcress Locus 16061038

Position : sca3 ( 5`- 3790353 .. 3791672 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478277 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16061038

Protein [Map View]
MTRLPLFVVLLLFTASFITPTAAEIKSLTISDDSRPMILFEKFGFTQSGHVSVSVSSVSVVSSSSVPIPDPSRLGFFLMS
EESLLQVVLEIEQNPNFCVLDSNYVLHLFTLKDLSSPPGSKYEHLYPVISPNEYSLFFVNCVPETKISMKVRTEMYNLDP
NGSKDYLPAGSTRLPGLYFFFSLGYLAFLGLWGYACWVNKRVVHRIHVLMAALLLMKALNLICAAEDKHYVKVTGTPHGW
DVLFYIFQFIRVVLLFTVIVLIGTGWSFLKPFLQEKEKNVLMVVVPLQVLANIASVVIGETGPFIKDWVTWNQIFLLVDI
VCCCAILFPIVWSIRSLRETSKTDGKAARNLAKLTLFRQFYIVVIGYLYFTRIVVFALKTIAAYKYRWVSNAAEEIASLA
FYMLMFYMFRPVEKNEYFVLDEEEEEAAELALKEDDFEL*

DNA
ATGACGAGACTACCCCTCTTCGTCGTCCTCCTACTCTTCACCGCAAGTTTCATCACTCCTACGGCGGCGGAGATCAAGTC
TCTCACAATTTCCGACGATTCTAGGCCGATGATTCTCTTCGAAAAGTTCGGATTCACTCAGTCCGGTCATGTTAGCGTCT
CTGTTTCCTCTGTATCAGTAGTATCTTCTTCGTCTGTTCCGATCCCAGATCCGTCGAGGCTAGGGTTCTTCCTTATGTCC
GAGGAATCGCTTCTCCAGGTAGTCTTAGAGATCGAGCAAAACCCTAACTTCTGTGTACTCGATTCCAATTACGTCCTCCA
TCTCTTCACATTAAAAGATCTCTCTTCTCCTCCTGGTTCCAAATACGAGCACTTGTACCCGGTGATTTCTCCGAACGAAT
ACTCTCTCTTCTTCGTGAATTGCGTACCGGAAACCAAAATTTCGATGAAGGTTCGAACGGAGATGTACAATTTAGACCCG
AACGGGTCTAAGGATTACCTCCCTGCCGGGTCAACCCGATTACCCGGATTGTATTTCTTCTTCTCCCTCGGCTACTTAGC
TTTCCTTGGTCTCTGGGGTTATGCTTGTTGGGTCAATAAACGTGTTGTTCATAGGATCCACGTTCTCATGGCGGCTCTGC
TTCTTATGAAGGCTTTGAATCTGATCTGTGCCGCCGAGGATAAGCACTACGTGAAAGTCACCGGTACTCCTCACGGCTGG
GATGTCTTATTCTACATTTTCCAGTTTATTCGTGTTGTTCTTCTCTTCACTGTCATTGTGTTGATTGGAACTGGCTGGTC
CTTCTTGAAGCCGTTCTTACAAGAGAAAGAGAAGAATGTGTTGATGGTTGTTGTCCCACTTCAGGTTCTCGCCAACATTG
CTTCCGTTGTGATTGGAGAGACTGGACCTTTTATTAAAGACTGGGTTACTTGGAATCAGATATTCTTGCTTGTAGATATA
GTTTGTTGTTGTGCAATCTTATTTCCTATTGTTTGGTCGATTCGTTCGCTAAGAGAGACTTCAAAAACCGATGGGAAAGC
GGCTAGGAACTTGGCGAAATTGACTCTGTTTAGACAATTCTACATTGTTGTCATCGGGTATTTGTACTTTACGAGGATTG
TAGTGTTTGCACTGAAGACAATCGCAGCTTATAAGTATCGGTGGGTGAGTAATGCAGCTGAGGAGATTGCAAGTCTGGCG
TTTTACATGTTGATGTTCTATATGTTCAGGCCGGTCGAGAAGAATGAGTATTTCGTTTTAGATGAAGAAGAAGAAGAAGC
CGCAGAGCTGGCCTTGAAGGAGGATGATTTTGAACTCTGA