Details for Lyrate rockcress Locus 16061013

Position : sca3 ( 5`- 2929812 .. 2930140 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16061013

Protein [Map View]
MNCKIGFMSFVVMTSLVILFLLVSGKVEAKPKCIGSCEILGDCGIACMKKGYLFGQCVGWSNPNTCCCGH*

DNA
ATGAATTGCAAGATTGGATTCATGAGCTTCGTGGTGATGACTTCATTAGTCATCCTATTTCTCTTGGTTTCAGGGAAAGT
TGAAGCTAAACCCAAATGCATTGGATCATGTGAAATACTTGGTGACTGTGGCATCGCTTGCATGAAGAAGGGATACTTAT
TTGGCCAATGCGTTGGCTGGAGTAATCCCAATACATGTTGTTGCGGCCATTAA