Details for Lyrate rockcress Locus 16060918

Position : sca1 ( 5`- 7685125 .. 7686335 -3` )
Annotation : [B2G] At3g10110 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16060918

Protein [Map View]
MADSNTETTGASSGSVGADENATQIQPIRMPTIEEIRAQEVWNNCAVRAVTSGVMGGGLGLMMGLFLGALDNPIMHDTMT
ARQQFVFTAKQMGQRSWNSCKTFAVMGLVFSAAECIVEKARAKHDTTNTAIAGCVTGGSMSARGGPKAACIGCAGFATFS
VLIEKFFDRHT*

DNA
ATGGCAGATTCGAATACTGAGACAACCGGTGCTTCTTCGGGCTCCGTGGGTGCTGATGAGAACGCTACCCAGATTCAACC
GATCCGGATGCCAACCATTGAGGAGATCCGAGCTCAAGAGGTTTGGAACAACTGCGCCGTTCGCGCTGTAACTAGTGGAG
TCATGGGAGGAGGACTCGGGTTGATGATGGGTTTGTTCTTGGGGGCACTAGATAATCCTATTATGCATGATACGATGACG
GCTAGGCAGCAGTTTGTGTTCACAGCAAAACAAATGGGCCAAAGGAGTTGGAATTCCTGTAAGACATTTGCGGTTATGGG
TTTGGTTTTCTCTGCAGCTGAATGCATTGTCGAGAAGGCAAGAGCGAAGCATGACACGACAAACACCGCTATAGCTGGAT
GTGTGACCGGTGGTTCAATGTCCGCCCGAGGTGGGCCAAAAGCTGCGTGTATAGGTTGCGCTGGCTTTGCAACTTTCTCT
GTACTCATAGAGAAGTTCTTTGATAGGCATACATAA