Details for Lyrate rockcress Locus 16060913

Position : sca3 ( 5`- 7198469 .. 7201628 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479152 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16060913

Protein [Map View]
MNPSHGRGLGSAGGSSSGRSQGGGETVVEMFPSGLRVLVVDDDPTCLMILERMLRTCLYEVTKCNRAEMALSLLRKNKHG
FDIVISDVHMPDMDGFKLLEHVGLEMDLPVIMMSADDSKSVVLKGVTHGAVDYLIKPVRMEALKNIWQHVVRKRRSEWSV
PEHSGSIEETGERQQQQHRGGGGGAAVSGGEDAVDDNSSSVNEGNNWRSSSRKRKDEEGEEQGDDKDEDASNLKKPRVVW
SVELHQQFVAAVNQLGAEAVPKKILELMNVPGLTRENVASHLQKYRIYLRRLGGVSQHQGNLNNSFMTGQDASFGPLSTL
NGFDLQALAVTGQLPAQSLAQLQVAGLGRPAMVSKSGLPVSSIVDERSIFSFDNTKTRFGEGLGHHGQQPQQQPQMNLLH
GVPTGLQQQLPMGNRMSIQQQIAAVRAGHSVQNNGMLMPIAGQQSLPRGPPPMLTSSQSSIRQPMLSNRISERSSFSGRN
NIPESSRVLPTGYTNLTTQHSSSAMAYNNYQPELPVNSFPLASAPGLSVPVRKATSYQEEVNSSEAGFTTPSYDMFTTRQ
NDWDLRNIGVAFDSHQDAESAAFSASEAYSSSSMSRNNTTVAATEHGRNHQQQPPGMVPHHQGYADGNSGSVRVKSERVA
ADTAAMAFHEQYSNQEDLMSALLKQEGIAPVDGEFDFDAYSIDNIPV*

DNA
ATGAATCCGAGTCACGGAAGAGGACTCGGATCGGCTGGTGGGTCTAGCTCCGGTAGAAGTCAAGGCGGTGGTGAGACCGT
CGTCGAGATGTTTCCTTCTGGTCTTCGAGTTCTTGTCGTTGACGATGACCCGACTTGTCTCATGATCTTAGAGAGGATGC
TTAGGACTTGTCTTTACGAAGTAACGAAATGCAACAGAGCAGAGATGGCATTGTCTCTGCTCCGGAAGAACAAACATGGA
TTTGATATTGTAATCAGTGATGTTCATATGCCTGACATGGACGGCTTCAAGCTCCTTGAACATGTTGGTCTAGAGATGGA
CTTACCTGTTATCATGATGTCTGCGGATGATTCGAAGAGTGTTGTTCTTAAGGGAGTGACGCACGGTGCGGTTGATTACC
TCATCAAGCCTGTACGTATGGAGGCACTTAAGAACATATGGCAGCATGTGGTTCGAAAGAGGAGGAGTGAGTGGAGCGTA
CCGGAACATTCTGGGAGCATTGAGGAGACCGGCGAGAGACAGCAGCAGCAACATAGAGGAGGTGGTGGTGGTGCAGCTGT
TTCTGGTGGCGAGGATGCGGTGGATGATAACTCTTCCTCGGTTAACGAAGGGAATAACTGGAGGAGCAGCTCACGGAAGC
GGAAAGACGAGGAAGGAGAAGAGCAAGGGGATGATAAGGACGAAGATGCGTCAAATTTGAAGAAACCGCGTGTTGTTTGG
TCTGTTGAATTGCATCAGCAGTTTGTTGCTGCTGTTAATCAGCTTGGCGCAGAGGCTGTTCCTAAGAAGATCTTAGAGCT
GATGAATGTTCCTGGGCTAACCCGAGAAAACGTAGCCAGTCACCTCCAGAAATACCGGATATATCTAAGACGGCTTGGGG
GAGTATCTCAGCACCAAGGCAATCTAAACAACTCGTTTATGACGGGTCAAGATGCAAGCTTCGGACCTCTTTCGACATTG
AATGGGTTTGATCTTCAAGCGCTAGCTGTCACAGGTCAGCTACCTGCTCAGAGCCTTGCACAGCTTCAAGTTGCTGGTTT
AGGCCGGCCTGCGATGGTCTCTAAGTCAGGTTTGCCGGTTTCCTCCATTGTGGACGAGAGAAGCATCTTCAGCTTTGACA
ACACGAAAACAAGATTCGGAGAGGGGCTTGGTCATCACGGGCAACAACCCCAACAGCAACCGCAGATGAACTTACTTCAC
GGTGTCCCGACAGGTTTACAACAACAGCTTCCTATGGGTAATCGAATGAGTATTCAACAACAGATCGCCGCTGTTCGAGC
CGGACATAGTGTTCAAAACAATGGAATGCTGATGCCTATAGCGGGTCAGCAATCTTTGCCTCGGGGACCACCGCCAATGC
TAACCTCGTCGCAATCATCCATCAGGCAGCCAATGTTATCAAACCGTATTTCCGAGAGAAGCAGTTTCTCTGGAAGGAAC
AATATCCCCGAGAGCAGCCGAGTTTTACCGACAGGTTACACCAACCTCACAACACAACACTCATCAAGCGCAATGGCCTA
TAACAACTACCAACCAGAACTCCCCGTGAACAGTTTCCCGCTAGCAAGTGCACCAGGCTTATCAGTTCCGGTTAGGAAAG
CCACTTCTTACCAGGAAGAGGTTAACAGCTCCGAAGCAGGATTCACCACCCCGAGCTACGACATGTTCACCACCAGACAG
AACGATTGGGATCTGCGGAATATTGGAGTAGCCTTTGACTCACATCAGGACGCAGAATCTGCTGCGTTTTCCGCTTCAGA
AGCTTACTCCTCTTCATCAATGTCAAGAAACAACACTACAGTAGCAGCCACAGAGCATGGCCGGAACCACCAGCAGCAAC
CTCCAGGAATGGTCCCGCACCATCAGGGTTATGCAGATGGAAACAGTGGTTCAGTGAGGGTGAAATCAGAGAGAGTGGCT
GCAGATACAGCAGCAATGGCGTTTCACGAGCAGTATAGTAATCAAGAAGATCTTATGAGCGCACTTCTTAAGCAGGAAGG
GATTGCACCGGTTGATGGAGAATTCGACTTTGACGCATACTCGATCGATAATATTCCGGTTTGA