Details for Lyrate rockcress Locus 16060903

Position : sca3 ( 5`- 6215270 .. 6216459 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16060903

Protein [Map View]
MSQEAAITSFKKFQESWIDQLRNHLNHLRSVQNHHRNSATGDEERLREAVERVMEHFREYHRAKWATTEKDVIGVMATPW
ASALERSLHWVGGWRPTTLFHLVYTESSILFESRIVDILRGFRTGDLSDLSPSQFRVKFVKGRTVSELQCETVNEENAIT
DELSEWQDDASDLVMGTSSDPEQRIRRLAEIVHRTDDLRLRTITRVVELLSPLQQAEFLIAAAELRTGVAGWGTSHDRRR
SSEV*

DNA
ATGAGCCAAGAGGCAGCGATAACGAGCTTCAAGAAATTCCAAGAGTCATGGATCGATCAGCTACGAAACCACCTGAACCA
CCTCCGCTCCGTCCAAAACCACCACCGGAATTCCGCTACCGGCGATGAGGAACGGTTAAGGGAAGCTGTGGAGAGAGTGA
TGGAACACTTTAGAGAGTACCACAGGGCCAAGTGGGCGACGACGGAGAAAGACGTGATCGGAGTTATGGCTACTCCTTGG
GCTTCAGCCCTTGAACGGTCACTCCATTGGGTCGGTGGTTGGCGACCAACAACCTTGTTTCATCTGGTTTACACTGAGTC
GAGTATTTTATTTGAGTCTCGTATCGTTGATATACTTCGTGGCTTTCGCACAGGTGACCTCAGCGATCTCTCTCCGTCTC
AGTTCAGGGTTAAATTTGTCAAAGGCAGGACGGTGAGTGAGCTACAATGTGAGACGGTGAATGAAGAGAACGCGATAACG
GACGAGTTATCGGAGTGGCAAGACGATGCGAGTGACCTCGTCATGGGGACCTCTTCCGATCCCGAGCAGAGGATCCGACG
GCTAGCAGAAATCGTCCATCGAACTGATGATCTGCGACTGAGAACGATCACACGCGTGGTGGAGCTCCTGAGTCCGCTCC
AACAAGCAGAGTTTCTTATCGCTGCGGCTGAGCTTCGTACCGGCGTTGCTGGTTGGGGGACTAGCCATGACCGTCGTCGA
AGTTCCGAAGTTTAA