Details for Lyrate rockcress Locus 16060901

Position : sca3 ( 5`- 5951066 .. 5957649 -3` )
Annotation : [B2G] phosphatidylinositol-4-phosphate 5-kinase family protein
External links : CoGe
PGDD synteny : 16060901

Protein [Map View]
MGTRDSNRTFSEIVGLIKSWLPWRSEPATVSRDFWMPDQSCRVCYECDCQFTLINRRHHCRLCGRVFCGKCTANSVPFAP
SDLRTPREEWERIRVCNYCFRQWQQGDGGPHVSNITELSTSPSETSLLSSKTSTTANSSSFALGSMPGLIGPCHRVHHGS
DVSLHGVSSMETSTTRQGKETSRRSSFIATDVEDPSRFALNRSDDEYEEYGVYQTDIETSHSPRANEYYGPMEYNGMSID
DGPCKHLSGETADQKSLSVSPLIHQCLESLIREGSEQFQKKGEHDGRDECEASSPADISDDQVVEPVDFENNGLLWVPPD
PENEEDERESALFDEEDNEGDTSGEWGYLRPSTSFGSGEYRGEDRTTEEHKKAMKNVVDGHFRALLAQLLQVENISVSDE
EGKESWLEIITSLSWEAANLLKPDMSKSGGMDPGGYVKVKCLASGFRHDSMVVKGVVCKKNVAHKKMSTKIEKARLLILG
GGLEYQRVSNQLSSFDTLLQQEKDHLKMAVAKIHAERPNILLVEKSVSRFAQEYLLAKDISVVLNIKRPLLDRIARCTSA
QIIPSVDHLSSQKLGYCENFRVDRFFEEHDSTGQVGKKVAKTLMYFEHCPKPLGFTILLRGANEDELKKVKHVVQYGVFA
AYHLALETSFLADEGASPELPLNSPITVALPDKSTSIERSISTVPGFTVSTYEKSPTMLSCAEPQRANSVPVSELLSTTT
NLSIQKDANPLIPNGSGWQAREINPSFIFSRHNVSLNLPDRVIESRNSDLSGRSVPVDTPVDKTNPVVVADDTVENSLHS
SGQGFVRKSSQSGTSIMVENQDNGSELTTVQQQINEKPKETQSQKEEFPPSPSDHQSILVSLSSRSVWKGTVCERSHLFR
IKYYGSFDKPLGRFLRDHLFDQSYRCRSCEMPSEAHVHCYTHRQGSLTISVKKLQDYLLPGEKEGKIWMWHRCLRCPRPN
GFPPATLRVVMSDAAWGLSFGKFLELSFSNHAAASRVACCGHSLHRDCLRFYGFGNMVACFRYATIDVHSVYLPPSILSF
NYENQDWIQRETDEVIERAELLFSEVLNAISQIAEKGFRRRIGELEEVLQREKSEFEENMQKMLHREVNEGQPLVDILEL
YRIRRQLLFQSYMWDHRLINASTLHKLENSDDTKREENEKPPLAKSQTLPEMNAGTNSLLTGSEVNLNPDGDSTGDTGSL
NNVQKEADTNSDLNHEKNDGGEVSPSKTLPDTSYPLENKVDVRRTQSDGQIVMKNLSATLDAAWIGERQTSVEIPTNNKV
LLPPSTMSNSSTFPPISEGLMPIDLPEQQNEFKVAYPVSPALPSKNYENSEDSVSWLSVPFLNFYRSINKNFLLSSQKLD
TFGEHSPIYISSFREAELQGGPRLLLPVGLNDIVVPVYDDEPTSMIAYALMSPEYQRQTSVEGESLVSYPSELNIPRPVD
DTIFDPSRSNGSVDESILSISSSRSSSLLDPLSYTKALHARVSYGEDGTLGKVKYTVTCYYAKRFEALRGICLPSELEFI
RSLSRCKKWGAQGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPAYFKYLSESISTKSPTCLAKILGIYQVATKQLKS
GKETKMDVLIMENLLFGRTVKRLYDLKGSSRARYNPDSSGSNKVLLDQNLIEAMPTSPIFVGNKAKRLLERAVWNDTAFL
ALGDVMDYSLLVGVDEEKNELVLGIIDFLRQYTWDKHLESWVKFTGILGGPKNEAPTVISPKQYKRRFRKAMTTYFLMVP
DQWSPPNVVANNSRSDQPEETSQAGTQAE*

DNA
ATGGGTACAAGAGATAGTAATAGGACATTCTCTGAGATAGTGGGTCTGATTAAATCCTGGCTTCCCTGGCGATCCGAGCC
AGCTACTGTGTCCAGGGATTTTTGGATGCCTGATCAGAGCTGTCGTGTATGTTACGAGTGTGATTGTCAGTTTACCCTCA
TCAATCGTAGGCACCATTGTCGTCTTTGTGGCAGAGTTTTCTGCGGCAAGTGTACAGCCAACTCAGTACCTTTTGCTCCC
AGCGACTTGAGAACTCCTCGTGAAGAGTGGGAGAGGATCCGTGTTTGCAATTATTGTTTCAGGCAGTGGCAGCAAGGTGA
TGGTGGACCACATGTTTCAAATATCACGGAACTTAGTACTTCACCTTCAGAGACAAGTCTTCTTAGCTCAAAGACCAGTA
CAACTGCCAATAGTAGTAGCTTCGCTCTTGGCTCGATGCCAGGACTGATTGGTCCTTGTCATAGGGTTCATCATGGTTCT
GATGTCAGCTTGCACGGAGTATCTTCAATGGAGACAAGCACGACCAGGCAAGGCAAAGAAACTTCGAGGAGGAGCAGCTT
CATTGCCACAGATGTGGAAGATCCATCTCGCTTTGCTTTAAATAGGAGTGATGATGAGTACGAAGAGTATGGTGTATACC
AGACTGATATTGAGACGAGTCATTCTCCTCGAGCTAATGAATATTATGGTCCCATGGAATACAATGGAATGAGCATTGAT
GATGGCCCCTGTAAGCATCTGAGTGGAGAAACCGCTGACCAGAAAAGTTTGAGCGTCTCGCCACTCATTCATCAGTGTCT
TGAATCTCTGATTCGGGAAGGATCAGAGCAATTCCAGAAGAAAGGTGAGCATGATGGTCGTGACGAATGTGAAGCTTCTT
CTCCAGCAGATATTTCAGATGATCAAGTGGTAGAACCGGTGGATTTCGAGAACAATGGACTTTTGTGGGTTCCACCTGAT
CCAGAAAATGAAGAAGACGAAAGAGAAAGTGCTTTGTTTGATGAGGAAGATAACGAGGGAGATACCTCAGGTGAGTGGGG
ATACTTACGACCTTCCACTAGCTTTGGAAGTGGAGAGTACCGTGGCGAGGATCGAACAACTGAAGAGCACAAGAAGGCTA
TGAAGAATGTGGTTGATGGGCACTTTAGGGCTTTGCTTGCACAACTTTTGCAAGTTGAGAACATCTCTGTGAGCGATGAA
GAGGGCAAAGAGAGCTGGTTAGAGATTATCACCTCTCTTTCTTGGGAGGCTGCTAACTTATTGAAGCCTGATATGAGCAA
AAGTGGAGGAATGGATCCTGGTGGCTATGTCAAAGTAAAGTGCCTAGCTTCTGGATTTCGACATGATAGCATGGTGGTGA
AGGGAGTTGTTTGCAAGAAAAATGTTGCTCATAAGAAAATGAGTACGAAGATTGAGAAAGCTCGACTTTTGATTCTAGGC
GGTGGACTTGAGTATCAAAGGGTCTCAAATCAGTTATCAAGTTTTGATACATTGCTGCAACAGGAAAAGGATCATCTAAA
GATGGCTGTTGCTAAGATTCATGCTGAACGTCCAAATATTCTACTAGTCGAAAAATCAGTTTCTCGATTTGCGCAAGAAT
ATCTTCTAGCCAAAGACATATCTGTTGTTCTAAACATCAAGAGGCCACTTCTAGACCGCATTGCTCGCTGCACTAGTGCT
CAAATAATTCCTTCAGTAGACCACCTCTCCTCTCAAAAGCTGGGTTACTGTGAGAATTTTCGGGTGGATAGGTTTTTTGA
GGAACATGATTCAACTGGTCAAGTTGGAAAGAAAGTGGCGAAGACGTTGATGTATTTTGAGCATTGTCCAAAACCATTAG
GCTTTACAATTTTGCTTAGGGGTGCAAATGAAGATGAGTTGAAAAAAGTGAAGCATGTGGTCCAGTATGGAGTTTTTGCA
GCTTATCATTTGGCACTCGAAACATCGTTTCTTGCTGATGAGGGAGCCTCACCTGAACTTCCTTTGAATTCCCCGATTAC
GGTGGCACTTCCGGATAAATCTACGAGCATTGAACGTTCAATATCTACTGTGCCAGGTTTCACGGTCTCAACATATGAAA
AATCTCCGACAATGCTATCTTGTGCTGAACCACAACGAGCAAACAGTGTTCCAGTATCTGAGTTGCTCTCGACCACTACC
AATCTATCCATCCAGAAGGATGCAAACCCTCTTATACCCAATGGTTCAGGCTGGCAGGCTAGAGAAATAAACCCGAGTTT
CATCTTTTCACGCCATAATGTTTCATTGAATTTGCCTGACCGTGTGATAGAGAGCAGAAACTCAGATTTGTCTGGAAGAT
CTGTACCGGTGGACACACCAGTTGACAAAACCAATCCAGTTGTTGTGGCAGATGACACAGTGGAAAATTCCTTACATTCA
TCAGGGCAAGGCTTTGTGCGAAAGAGTTCTCAAAGTGGTACGAGCATTATGGTCGAAAACCAAGACAATGGTTCAGAGCT
TACAACCGTCCAACAACAAATCAATGAGAAACCAAAGGAAACACAATCCCAAAAAGAAGAATTTCCTCCGTCACCCTCTG
ACCACCAGAGCATTTTGGTTTCTCTATCTTCCCGATCAGTGTGGAAAGGAACTGTGTGCGAGAGGTCTCACCTCTTTCGG
ATAAAATACTATGGTAGTTTTGATAAACCCTTGGGACGGTTCTTGAGAGATCATTTGTTCGATCAGAGTTACAGGTGCCG
GTCATGTGAGATGCCATCAGAAGCTCATGTTCATTGTTACACTCATCGACAAGGCAGCCTTACTATATCTGTCAAGAAGC
TCCAAGATTATCTCTTACCTGGTGAAAAGGAGGGGAAGATCTGGATGTGGCATAGATGCCTGAGATGCCCGCGACCTAAC
GGCTTCCCTCCAGCGACTCTACGAGTGGTTATGTCTGATGCTGCATGGGGATTATCGTTTGGGAAGTTTCTGGAGCTCAG
TTTCTCAAATCACGCAGCTGCTAGTAGAGTAGCTTGTTGTGGCCATTCTCTGCATAGAGATTGTCTTCGCTTCTATGGCT
TTGGGAACATGGTTGCTTGCTTCCGGTACGCTACTATAGATGTTCATTCTGTCTACCTTCCACCATCAATTCTTAGTTTC
AACTATGAGAATCAGGACTGGATACAGAGAGAGACAGATGAGGTGATAGAGAGAGCAGAGCTTCTGTTTTCTGAAGTATT
AAATGCTATTAGTCAAATTGCAGAGAAAGGTTTTAGGCGTCGAATTGGTGAACTCGAAGAAGTGCTGCAAAGAGAGAAAT
CAGAATTTGAGGAGAATATGCAAAAGATGTTGCACAGGGAGGTGAACGAAGGCCAACCTCTCGTGGACATTCTTGAGCTA
TATCGGATTCGCAGACAACTGCTTTTTCAGTCATACATGTGGGATCACCGCTTGATTAATGCATCTACTTTACATAAGCT
TGAGAATAGTGATGACACAAAGAGAGAAGAGAACGAGAAACCTCCCTTGGCTAAGAGCCAGACGCTCCCCGAGATGAATG
CTGGGACCAACTCTCTTCTTACTGGCTCAGAGGTTAATCTGAATCCTGATGGTGATTCTACTGGTGACACTGGCTCCTTA
AATAATGTTCAGAAGGAAGCGGATACAAATTCAGATTTGAATCACGAAAAGAATGATGGGGGAGAAGTTTCTCCCAGCAA
GACCTTACCAGATACATCTTATCCTCTGGAAAATAAAGTCGATGTTCGTAGAACACAGTCTGATGGCCAGATAGTTATGA
AAAATCTATCAGCCACTCTTGATGCAGCATGGATAGGTGAACGTCAAACATCTGTGGAGATTCCAACCAACAATAAGGTC
TTGCTTCCTCCTTCCACCATGTCAAACTCTTCAACTTTTCCTCCAATCTCAGAGGGGCTAATGCCTATAGACCTCCCAGA
ACAGCAAAATGAATTCAAGGTGGCCTATCCTGTTTCCCCAGCATTACCAAGTAAGAATTATGAGAATTCAGAAGACTCTG
TCAGCTGGTTAAGTGTGCCATTCCTCAACTTCTACCGTTCCATTAACAAGAATTTCCTGCTTAGCTCTCAGAAGCTTGAT
ACATTTGGCGAGCATAGCCCTATCTATATTTCATCTTTTAGAGAGGCAGAACTTCAAGGTGGACCAAGGCTACTTCTGCC
CGTAGGCTTAAATGATATTGTCGTTCCGGTTTATGATGATGAACCCACTAGTATGATCGCATATGCCTTGATGTCACCGG
AATATCAACGCCAAACTTCTGTTGAAGGGGAATCTCTAGTTTCATATCCTTCTGAACTCAATATCCCTCGCCCAGTTGAT
GACACCATTTTTGACCCTAGCAGAAGCAATGGTTCAGTCGACGAGAGCATACTTTCAATATCCTCATCTCGCAGTAGCTC
ACTTTTGGACCCACTATCATATACAAAAGCTTTACATGCTCGAGTCTCATATGGAGAGGACGGTACGCTTGGAAAAGTGA
AGTACACTGTTACTTGTTACTATGCAAAACGATTTGAGGCGCTGCGGGGTATATGTCTCCCTTCGGAACTCGAGTTTATA
AGGTCTCTTAGCCGGTGTAAAAAATGGGGAGCTCAAGGTGGCAAGAGCAATGTCTTCTTTGCTAAAACCCTGGATGATCG
ATTTATCATCAAGCAAGTCACCAAGACAGAGTTGGAATCATTCATCAAATTTGCACCTGCTTACTTCAAATACTTATCTG
AGTCTATCAGCACGAAAAGCCCAACCTGCCTGGCAAAAATATTGGGAATCTATCAGGTCGCAACAAAGCAACTTAAGAGC
GGGAAAGAAACAAAGATGGATGTTCTGATTATGGAGAATCTTCTGTTTGGAAGAACTGTGAAACGGCTATATGACCTTAA
AGGATCTTCCCGGGCGCGCTACAATCCTGACTCCAGTGGGAGCAACAAAGTCTTGTTGGATCAAAACTTGATTGAAGCAA
TGCCAACTTCTCCCATTTTCGTTGGTAACAAAGCAAAACGATTGTTGGAAAGAGCTGTCTGGAATGATACTGCTTTTCTT
GCATTGGGTGATGTGATGGATTATTCGTTGCTAGTAGGCGTGGATGAAGAAAAGAACGAGCTAGTTCTCGGGATTATCGA
CTTCTTGAGGCAGTACACATGGGACAAGCATCTAGAGTCTTGGGTGAAATTTACAGGAATCTTAGGAGGACCAAAGAATG
AAGCACCAACAGTAATATCTCCAAAGCAATACAAGAGAAGATTCAGAAAGGCGATGACAACTTACTTCCTCATGGTCCCT
GATCAATGGTCTCCTCCTAATGTCGTTGCGAATAACTCCAGGTCTGATCAACCTGAAGAAACCTCTCAAGCCGGTACACA
AGCAGAGTGA